tag:blogger.com,1999:blog-2743690106034386179Wed, 06 Nov 2024 03:05:59 +0000makeupskincaredrugstoreperfumefragrancehairbodycareshoppingnail polishhome decorhigh endrandomlipstickcandlesweetcatricebudgetfashioncookinghaulhaircarefloralfoundationinterior designyankee candlebourjoisessencebloggingbooksfavouritesfallnaturalMACbaleagiveawayvichybeautyblusherfruitymaybellinepersonalrensummerLushYves Rocheracneblushessieeyeshadowkikolipglossmakeup revolutionrimmeltipsafroditajewelrylifestyleonline shoppingoriflamerevlonspringconcealerfrench pharmacylorealmascarapinkwinteravonbritney spearsemptiesgarnierhealthyla roche posaynailsDIYReal Techniquesarmanibody carecartierchina glazecorine de farmedessertdr schellerestee lauderfavoritesfreshgot2bgreen beautyguerlainguest posthappy-go-healthy girlhave you discoveredhighlighterhomejohn friedalipsluxurymodels ownnudeorlyoutfitpalettereciperedkenshoesshower gelspicythe body shopthe valentine projecttigiurban decayweledawishlistaccessoriesanastasiaartistryaussiebrushcitrusclarinsdeborahdoveeyebrowsfoodgivenchyif you only buy one things this weekjuicy couturelaveramama naturemanicuremarc jacobsmilanimuskyneutrogenanotdpowderthe balmvera wang& other storiesBECCAChristmasFOTDH&MTilen Time Thursdayaquolinaasian cosmeticsbarry mbiodermablogsblogs of the weekbocassybrushesburts beescandlescaudaliecece of swedenchloeciateclick2chiccollectioncruelty freedietingdrogerie marktdry hairedpedtelfetude houseeventfragrance directi lovejimmy chookardashian beautykaty perrykorresl'erbolariol'oreallip balmlolita lempickamattemax factormennanshyneutralnina ricciniveanyxogxoily skinopiorganisationphotographypost ideaspradapreviewprimarkprimerproblematic skinproject 10 panreadingsatiniqueshowersleeksubrina professionalsunday rileytagtoo faceduna brennanupcomingvictoria's secretwardrobezarazuiiAmwayCosmopolitanL'OccitaneNARSNotinoYoutubeadvertisersadvertisingagent provocatueralpstoriesalverdeantipodesapartmentastorautumnbabushkaback to schoolbagbasebathbb creambedheadbenecosbenefitbest kept secretsbody mistbomb cosmeticsbreakfastbrowsbvglaricakecandlelitechanelcharles worthingtoncharlotte tilburycheekschocolateciatécliniquecocoa browncold weathercollistarcoloramacombination skincomparisionconditionercontact lensescontestcookiescooking schmookingcoralcult beautydamaged hairdavidoffdehydrated skindelaromdesigndisappointingdknydrinkdry skineau intenseebookecosseelie saabelizabeth ardeneosessentialseveningeyelinerfeel uniquefeeluniquefrgarancefruitgift guidegladegreengreen linehair carehair maskhalloweenhand creamheidi swapphighligterhmhoneyi heart makeupindian summerinikainternationalisadoralancomelanvinle couvent des minimeslily flamelip butterliplinerliquid lipstickliving roomlotionmadonnamagazinesmaltamarlenhamelvitametallicmicellar solutionminimalmiss copycatmonoimorningmujimulondonmuradmusicmust havenatural collectionnew adultnotebooksolazorganicoriginsouaipaco rabannepaco rabbaneparfums d'orsaypatchoulipaula's choicepercy & reedphipizzaplannerplanningprincessredreviewroomsalmasample sundayschwarzkopfsecret kisssensaisephorashalimarshampooshare the loveshiseidosisitessnacksoapsoap and glorysoapysoupsunglassesswapswatchestangle angelterry de gunzburgtimothy dunntom fordtourtraveltvupdateveganvideovisiomaxwax tartsyslyummyzoellazoevaNothin' Fancy. Really.A lifestyle blog.http://nothinfancyreally.blogspot.com/noreply@blogger.com (Živa)Blogger418125tag:blogger.com,1999:blog-2743690106034386179.post-6951227598878596988Thu, 10 Dec 2020 10:22:00 +00002020-12-10T11:22:44.454+01:00candlesfragranceperfumerandomA Random's Girl's Best Of 2020: Candles, Perfumes and Everything That Smells Nice, oh my!<p></p><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQ4qrltzv1QWTIjGOlNMyTdLXMIYwoVLpswVoP_whZHj36P-wSO0xxINYqU2gbUUTM-ELb7-Virey5Ovy138TAe4sflU60vYJDzlTKytgoY8VYmO5Ek9gEyWh0jFKqGSnR1RMnsr0569Oo/s2048/IMG_9617.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQ4qrltzv1QWTIjGOlNMyTdLXMIYwoVLpswVoP_whZHj36P-wSO0xxINYqU2gbUUTM-ELb7-Virey5Ovy138TAe4sflU60vYJDzlTKytgoY8VYmO5Ek9gEyWh0jFKqGSnR1RMnsr0569Oo/s16000/IMG_9617.jpg" /></a></div>&nbsp;<div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjYDGEAqpWMFmiVr1Sgd8-S1D315JhwP6cXALvuw4P2R0gonsnzvZQnIVrXoa_el9QQc2jydyJqbz-WmEv6CvDyRA9LxbPYLOgREPMuZk7FRLx10CWLQAlvXxPf8klkRN9me7cmpJ8Ll4_8/s2048/IMG_9618.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1536" data-original-width="2048" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjYDGEAqpWMFmiVr1Sgd8-S1D315JhwP6cXALvuw4P2R0gonsnzvZQnIVrXoa_el9QQc2jydyJqbz-WmEv6CvDyRA9LxbPYLOgREPMuZk7FRLx10CWLQAlvXxPf8klkRN9me7cmpJ8Ll4_8/s16000/IMG_9618.jpg" /></a></div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">You (hopefully) know I'm a fragrance addict, right? Today I compiled a list of my favorites from 2020 - things that I've found this year or that I've been using for years beforehand. These are all products that get my kiss of approval and I think you'd love them as well!</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h2 style="clear: both; text-align: center;">Let's see what I've been loving...</h2><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.ilkos.si/" target="_blank">Ilkos Candles</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">This was a very recent discovery but I LOVE these candles. They are inexpensive but very heavily scented so they really make any room smell amazing. They have a special Christmas collection available right now which is just wonderful. I can't recommend any specific scent because I've tried most of them and loved them all! I can't wait to get more candles from them.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/jennifer-lopez/glow-by-jlo-toaletna-voda-za-zenske/" target="_blank">J.Lo Glow EDT</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">If you need a scent that makes you feel instantly refreshed and ready to start the day, this is the one for you. It smells like baby powder and soap and it's so crisp and fresh and just perfect, I adore it. I go through this like water but it is actually really strong and lasts quite a while. Plus, it's a total bargain!</div><h3 style="clear: both; text-align: center;"><br />Profissimo Perfume Oil Apple Cinnamon</h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">I've been really into using my diffuser lately (I'll make a separate post about this) and this oil has been one of my absolute favorites. You can grab it in Drogerie Markt for the bargainous price of under 2€. Ridiculous! It's perfect for this season and a great alternative to expensive candles.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/paco-rabanne/olympea-legend-parfumska-voda-za-zenske/" target="_blank">Paco Rabanne Olympea Legend EDP</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">This is my favorite perfume of all time. I get compliments on it from strangers. STRANGERS! I don't know about you but that's never happened to me before with any other scent. This is lick-your-fingers good. Sweet, sexy and opulent. It's also the boyfriend's favorite scent. I can't get over this one and this is my 2nd bottle.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/paco-rabanne/pure-xs-for-her-parfumska-voda-za-zenske/" target="_blank">Paco Rabanne Pure XS EDP</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">Another favorite from Mr. Rabanne. This is a bit more generic, but still sexy. Sweet, heavy, opulent, comforting. I adore this scent and have been wearing almost daily since it got cold (I save Olympea for special occasions). It makes me feel cozy and warm and I just adore it.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.zoflora.co.uk/" target="_blank">Zoflora</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">A recent find, but an invaluable one! Zoflora is a British disinfectant cleaning... thing that you need to dilute (because otherwise it's flammable!) I use it for anything and everything - wiping down surfaces mostly. You can also check Youtube for tips on how to use it, there are soooo many uses for it! I'm planning on getting a steam mop so I can clean the floors with it. It smells amazing and there are so many scents to pick from! Linen Fresh is my fav for the bedroom and Warm Cinnamon is my seasonal favorite for the rest of the apartment.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/armani/acqua-di-gioia-parfumska-voda-za-zenske/" target="_blank">Armani Acqua di Gioia EDP</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">If you've been reading my blog for a while, you're probably well aware this is a long-time favorite of mine. I adore this perfume. It's fresh, sweet, sexy and lasts pretty well. I even have an engraved bottle now that I got for my birthday from my in-laws! You absolutely need this perfume for summer. It's my signature scent!</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/kim-kardashian/pure-honey-parfumska-voda-za-zenske/" target="_blank">Kardashian Pure Honey EDP</a></h3><div class="separator" style="clear: both; text-align: center;">Listen here. I didn't buy this because I'm a Kardashian fan. I bought it because I wanted a honey scent that was more honeycomb than honeysuckle. And man, does this one deliver. It's deep, special, different and sweet in a totally unique way. It's cozy, comfy, heavy, thick. I absolutely adore this scent for layering as well. And it's soooo inexpensive.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">So those have been all my favorite scents of 2020. I hope you found some gems in this post!</div><h2 style="clear: both; text-align: center;">I'd love to know - what was your favorite scented product of 2020?</h2><p></p>http://nothinfancyreally.blogspot.com/2020/12/a-randoms-girls-best-of-2020-candles.htmlnoreply@blogger.com (Živa)0tag:blogger.com,1999:blog-2743690106034386179.post-5252537668904899251Wed, 09 Dec 2020 10:39:00 +00002020-12-09T11:45:07.053+01:00booksmusicrandomtvA Random Girl's Best Of 2020: Books, Netflix and Music<p style="text-align: center;"></p><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaHFrJL16pfhHxy5IOe6K7dGp-DwSPq-0Q9d5OqfprADSNTaDhBq65vvITa2U-eGADboqX0ytUy6eIj3nSiTZYhyg8kJe_coiBjJjPleoyeC39hIPIhirMHhHkLEL-79TW5bfnM5Htx84b/s2048/IMG_9608.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaHFrJL16pfhHxy5IOe6K7dGp-DwSPq-0Q9d5OqfprADSNTaDhBq65vvITa2U-eGADboqX0ytUy6eIj3nSiTZYhyg8kJe_coiBjJjPleoyeC39hIPIhirMHhHkLEL-79TW5bfnM5Htx84b/s16000/IMG_9608.jpg" /></a></div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEglC785zmZylBpLuJjvhDK70yVevfWkLZCLLShGr60L_Z3YICPCDy0UzwxPmFoR9Tj0dTJfepSca4sANif62cmAVQAujSZa4ZQ8MuMlJqFCHxOI7TV2W-2YczaGcSnvgrFO97bHeokHyPdL/s2048/IMG_9610.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEglC785zmZylBpLuJjvhDK70yVevfWkLZCLLShGr60L_Z3YICPCDy0UzwxPmFoR9Tj0dTJfepSca4sANif62cmAVQAujSZa4ZQ8MuMlJqFCHxOI7TV2W-2YczaGcSnvgrFO97bHeokHyPdL/s16000/IMG_9610.jpg" /></a></div><br />&nbsp;<p></p><p style="text-align: center;">I love all kinds of media and like probably everyone else this year, I, too, have binged Netflix hard. I've got some recommendations on my favorites of this year below. I would love to know what you enjoyed this year in the comments below!</p><p style="text-align: center;"><br /></p><h1 style="text-align: center;">Netflix </h1><div><br /></div><h3 style="text-align: center;">Breaking Bad</h3><div><br /></div><div style="text-align: center;">This year, my boyfriend forced me to watch this show. I'd been dreading it for years. But then we started. And from the first episode I was totally hooked! We watched the whole show over a couple of months and I cried A LOT while watching it. Embarrasingly-a-lot, to be exact. Boyfriend wants to carry on with Saul but I'm being a brat. Maybe next year.</div><div style="text-align: center;"><br /></div><div><h3 style="text-align: center;">Brooklyn Nine Nine</h3></div><div><br /></div><div style="text-align: center;">Andy Samberg is my favorite! OMG this show is so good. If you miss sitcoms like Friends, Parks and Rec and The Office, you're gonna love this cop show. It's short, funny, not insensitive, and really adorable. I love it.</div><div style="text-align: center;"><br /></div><h3 style="text-align: center;">Drag Race</h3><div><br /></div><div style="text-align: center;">I didn't get it at first. 14 US seasons, 1 UK season (several watched twice, some three or four times...) later and I'm a convert. I fucking LOVE this show. My favorite contestants? I'm so glad you asked. I LOVE: Sasha Velour, Violet Tchatchki, Gigi Gorgeous (#robbed), Brooklyn Hytes, Trinity, Shea and Pearl! I hope there's a new season soon PLEASE!</div><div style="text-align: center;"><br /></div><h3 style="text-align: center;">Emily in Paris</h3><div><br /></div><div style="text-align: center;">I watched this in 3 days. Then I watched it again. And then I made the boyfriend watch it with me and even he's not complaining about it that much so THERE. It's cute. Like Gossip Girl for adults. In Paris instead of New York. And with more di...</div><div style="text-align: center;"><br /></div><h1 style="text-align: center;">Books</h1><div><br /></div><div style="text-align: center;"><h3><a href="https://www.bookdepository.com/Tokyo-Bicycle-Bakery-Su-Young-Lee/9798677593451?ref=grid-view&amp;qid=1607510695157&amp;sr=1-4" target="_blank">The Tokyo Bicycle Bakery</a></h3><div><br /></div><div>I picked this up randomly and fell in love. Magical realism that's so gentle and bittersweet you can almost taste the moment before it's gone. It has yummy descriptions of food, a beautiiiiiiful story, and it made me cry. Buy it. Read it. Love it. P.S. If you were crazy about that Johny Depp flick Chocolat back in the day YOU WILL LOVE THIS.</div><div><br /></div><h3><a href="https://www.bookdepository.com/We-Are-Okay-Nina-LaCour/9780142422939?ref=grid-view&amp;qid=1607510683625&amp;sr=1-1" target="_blank">We Are Okay</a></h3><div><br /></div><div>OMG listen why do all these books make me cry? It deals with grief and it hits hard. But it's beautiful and important. It helped me come to terms with things I've held back for years. I loved it and cannot wait to pick up more of Nina LaCour's books.</div><div><br /></div><h3><a href="https://www.bookdepository.com/Little-Deaths-Emma-Flint/9781509826582?ref=grid-view&amp;qid=1607510670782&amp;sr=1-1" target="_blank">Little Deaths</a></h3><div><br /></div><div>I know my friend <a href="https://www.instagram.com/ninainthespring" target="_blank">Nina </a>didn't enjoy this one so much (YES I stalked you on Goodreads. Whatchu gonna do about it?) but I loved it... It was dark, super atmospheric (hot NYC summer, oppressive, grungy, thick with cigar smoke) and kept me guessing. I'm so excited for this author to write more.</div><div><br /></div><div><h1>Music</h1></div><div><br /></div><div>Like everyone and their dog, I got my Spotify round-up and shared it in an embarrassingly high amount of places given that nobody cares. Anyway, I don't know why I was so insistent on posting everywhere because it's shameful AF. My #1 genre is Pop. I shouldn't be surprised because Britney is queen #FreeBritney #LeaveBritneyAlone #OtherTrendingBritneyHashtags But if you're looking for some good new music, I recommend Sleepy Fish (lo fi) as well as Qveen Herby who was my obsession for the year.</div><div><br /></div><h3>That's the media that's shaped my year! What have you been enjoying music, Netflix and reading-wise? Tell me in the comments!</h3><div><br /></div></div>http://nothinfancyreally.blogspot.com/2020/12/a-random-girls-best-of-2020-books.htmlnoreply@blogger.com (Živa)0tag:blogger.com,1999:blog-2743690106034386179.post-6778510448424900497Tue, 08 Dec 2020 08:45:00 +00002020-12-09T11:16:54.857+01:00drugstorefavoriteshigh endmakeupA Random's Girl's Best Of 2020: Makeup Favorites<p style="text-align: center;"></p><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgY18q3k1JYmDwKG-AboIBxymNav4jaP_BtxEqzoIRqc2u0Df-uWlFzvwqA4oEtqBnVRoJYZyMADp2kspDB6raukkfEViQ4VqrFbkx_QBh9lLXP_Eub9AsEajpQK7mCpU2mmfvbceW1gEOH/s2048/IMG_9499.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgY18q3k1JYmDwKG-AboIBxymNav4jaP_BtxEqzoIRqc2u0Df-uWlFzvwqA4oEtqBnVRoJYZyMADp2kspDB6raukkfEViQ4VqrFbkx_QBh9lLXP_Eub9AsEajpQK7mCpU2mmfvbceW1gEOH/s16000/IMG_9499.jpg" /></a></div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUFd8XIjN5M5zVevMhnlGiEGxIwffHGF8iONG09fRXBJUlf7Jegc-9tymmVpO8WaIRIeDPCV6QBWTMElYDuxncgzEDWF2-oopivg0VYY5yu3FXEGGyL_RLgEoECZ_B5K_zkgu1JzXBFBlj/s2048/IMG_9500.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1536" data-original-width="2048" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUFd8XIjN5M5zVevMhnlGiEGxIwffHGF8iONG09fRXBJUlf7Jegc-9tymmVpO8WaIRIeDPCV6QBWTMElYDuxncgzEDWF2-oopivg0VYY5yu3FXEGGyL_RLgEoECZ_B5K_zkgu1JzXBFBlj/s16000/IMG_9500.jpg" /></a></div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgxFyNypLST1Hi11BnagLv3iqWBMxvxMwGavk1fZGmT7FEFuX-6WIFW8E7fkuQ10wr-lqotzLuTCF8iiH6UNwM-Ss9kmT5TLTPhemeJKsj20nP4fHG62HGA7EldUWTMwOJA4uGBwnEtoIqG/s2048/IMG_9504.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="2048" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgxFyNypLST1Hi11BnagLv3iqWBMxvxMwGavk1fZGmT7FEFuX-6WIFW8E7fkuQ10wr-lqotzLuTCF8iiH6UNwM-Ss9kmT5TLTPhemeJKsj20nP4fHG62HGA7EldUWTMwOJA4uGBwnEtoIqG/s16000/IMG_9504.jpg" /></a></div><br />&nbsp;<p style="text-align: center;">Time to talk makeup! Honestly, I feel like I'm stuck in a rut with my makeup. It always looks the same! I think I need to figure out something to change because I'm getting sooo bored of painting the same face every day.&nbsp;</p><p style="text-align: center;"><br /></p><h3 style="text-align: center;">Anywayyyyyy, if you want to see my favorite products of 2020, keep reading!</h3><div><br /></div><h4 style="text-align: center;"><a href="https://eu.feelunique.com/p/Essence-Lash-Princess-False-Lash-Effect-Mascara-12ml?q=essence%20false%20lash&amp;q_typ=a&amp;q_cat=product&amp;q_dep=Makeup%2CEyes" target="_blank">Essence Lash Princess False Lash Effect Mascara</a></h4><div><br /></div><div style="text-align: center;">Oh Essence, how I love thee. <b>Affordable, adorable and irresistible</b>, that should be their slogan. I just adore this mascara. It makes my lashes so <b>longggg</b>, and super voluminous too if I do a second coat. I wouldn't layer it over 2 times though. Ya girl has had some very clumpy/Twiggy lash experiences with 3 coats...&nbsp;</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://eu.feelunique.com/p/Milani-Baked-Blush-35g?q=luminoso&amp;q_typ=f" target="_blank">Milani Luminoso Baked Powder Blush</a></h4><div><br /></div><div style="text-align: center;">Can you say #OldieGoldie? This used to be everyone's favorite and I used to buy Milani from a Polish website when you couldn't get it anywhere else. #EmphasisOnTheOldie This shade is the <b>perfect peach and brightens cheeks for a beautiful glow</b>. Packaging could be better, though.</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://eu.feelunique.com/p/NYX-Professional-Makeup-Cant-Stop-Wont-Stop-24-Hour-Foundation-30ml?q=can%27t%20stop%20won%27t%20stop&amp;q_typ=a&amp;q_cat=product&amp;q_dep=Makeup%2CComplexion" target="_blank">NYX Can't Stop Won't Stop Full Coverage Foundation</a></h4><div><br /></div><div style="text-align: center;">Okay so, I finally found a shade that's too light for me! After years of being always-slightly-too-orange, I am amazed that I can now look 3 shades lighter from the neck up! Okay but seriously, this is really <b>thick and covers up a multitude of sins</b> including that Sunday you decided to say fuck it and have a glass of wine too many, and you have a Zoom meeting in 15 minutes, and you slap this on, and suddenly it's like, dark circles <i>who</i>? It's a great foundation is my point.</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://www.beautybay.com/p/bh-cosmetics/brilliance-bronzers/golden-gal/" target="_blank">BH Cosmetics Brilliance Bronzer in Golden Gal</a></h4><div><br /></div><div style="text-align: center;">Listen, I don't know how to use bronzer. Usually I grab the one brush I don't know what to use for, kind of swirl it in there, put it in random places and hope for the best. BUT this has been my best friend and made me look SO much more alive. If NYX gives the perfect canvas, this adds <b>dimension</b>. It's a beautiful bronzer. I'm impressed!</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://eu.feelunique.com/p/Real-Techniques-Miracle-Complexion-Sponge-Duo-Pack?q=miracle%20%20c&amp;q_typ=a&amp;q_cat=product&amp;q_dep=Makeup%2CComplexion" target="_blank">Real Techniques Miracle Complexion Sponge</a></h4><div><br /></div><div style="text-align: center;">It's just the best one out there. I love the BeautyBlender but 1. this cheaper 2. this harder and better to apply foundation with. I keep buying the double packs like an addict. They're so squishy, Imgonnadie!</div><div style="text-align: center;">I use this to <b>apply foundation</b>. And if you didn't know like me, you're supposed to <b>wet them</b> before you apply.&nbsp;</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://www.maccosmetics.com/product/13854/36169/products/makeup/lips/lipstick/cremesheen-lipstick#!/shade/Cr%C3%A8me_In_Your_Coffee" target="_blank">MAC Creme in Your Coffee Lipstick</a></h4><div><br /></div><div style="text-align: center;">This is such a gorgeous<b> neutral, creamy</b> shade. I LOVE how it looks in the fall and winter. For spring, summer, it's a little too dark for me. BUT for a S/S option, I love...</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://www.charlottetilbury.com/us/product/matte-revolution-lipstick-pillowtalk" target="_blank">Charlotte Tilbury Bond Girl Lipstick</a></h4><div><br /></div><div style="text-align: center;">This gorgeous color is a little more on the <b>pink, vibrant nude</b> side and looks beautiful in all seasons. It's creamy and very opaque. Worth the money!</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://www.sephora.com/product/everlasting-love-liquid-lipstick-P384954" target="_blank">Kat Von D Liquid Lipstick in Lolita</a></h4><div><br /></div><div style="text-align: center;">This is the easiest shade to wear. It <b>dries fast and looks good without smudging </b>until you eat or drink, and even then it fades in a pretty way. This is my favorite liquid lipstick of all time.</div><div style="text-align: center;"><br /></div><div style="text-align: center;"><br /></div><div style="text-align: center;">I thought about including more products but I really think this is the best of the best. If you have tried any of them, I'd love to know your thoughts.</div><div style="text-align: center;"><br /></div><h2 style="text-align: center;">What was your standout makeup product of 2020?</h2>http://nothinfancyreally.blogspot.com/2020/12/a-randoms-girls-best-of-2020-makeup.htmlnoreply@blogger.com (Živa)0tag:blogger.com,1999:blog-2743690106034386179.post-4681621451969728254Mon, 07 Dec 2020 08:39:00 +00002020-12-07T09:42:39.042+01:00beautyfavoritesskincareA Random Girl's Best Of 2020: Skincare Edition<p style="text-align: center;"></p><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEinGpHvYz8PAgqamb8VR1Br3Xbm7lwPevAcP5WcpA5zQl1KR-yxVlR8fwcUgofoabCkGydCbatTQENaz5bqy65x5zR70V6whS4jpB3r6lqjw5N49Dq8kOqWZM5tXOtquxR3KTuAzq_vU4rU/s2048/img_9463.jpg" style="margin-left: 1em; margin-right: 1em;"><span style="font-size: large;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEinGpHvYz8PAgqamb8VR1Br3Xbm7lwPevAcP5WcpA5zQl1KR-yxVlR8fwcUgofoabCkGydCbatTQENaz5bqy65x5zR70V6whS4jpB3r6lqjw5N49Dq8kOqWZM5tXOtquxR3KTuAzq_vU4rU/s16000/img_9463.jpg" /></span></a></div><span style="font-size: large;"><br /></span><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhf22Jjn6HDlqbK5bea7B3N9ztdpNtybqQBIct_yg7tZHh6jSmrvbFKdGedkieMasPR61YZ839_gpgfOY7InWGsQs0GjiYel3XjD97ksolGblKAnWF_m1a08-xHENlT3RXVwZHot-j5QV1h/s2048/img_9466.jpg" style="margin-left: 1em; margin-right: 1em;"><span style="font-size: large;"><img border="0" data-original-height="1536" data-original-width="2048" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhf22Jjn6HDlqbK5bea7B3N9ztdpNtybqQBIct_yg7tZHh6jSmrvbFKdGedkieMasPR61YZ839_gpgfOY7InWGsQs0GjiYel3XjD97ksolGblKAnWF_m1a08-xHENlT3RXVwZHot-j5QV1h/s16000/img_9466.jpg" /></span></a></div><p></p><p style="text-align: center;"><span style="font-size: large;"><br /></span></p><p style="text-align: center;"><span style="font-size: large;">I feel I've been away for so long I have to address it in some way, but I don't really feel like it, so let's move on to what skincare I've been using for this past year!</span></p><p style="text-align: center;"><span style="font-size: large;"><br /></span></p><p style="text-align: center;"><span style="font-size: large;">But first a little introduction to my skin (and me, in case you're new/forgot I exist): I'm Živa, I'm turning 30 next year and my skin has somehow gone from acne-prone to kinda sensitive and dry. But I feel like I'm getting way better at figuring out what works for me and my skin.</span></p><p style="text-align: center;"><span style="font-size: large;"><br /></span></p><h2 style="text-align: center;"><span style="font-size: x-large;">So here's a list of some tried-and-loved products!</span></h2><div><span style="font-size: x-large;"><br /></span></div><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/NIPFAB-Vitamin-C-Fix-Brightening-80-Pads?q=nip+%2B+fab+pads&amp;q_typ=f" target="_blank">NIP+FAB Vitamin C Fix Brightening Pads</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">Okay, seriously? These don't make a huge change to the <i>look </i>of my skin but they make it <b>feel plumper, fuller and softer</b>. Plus they smell like <b><i>oranges</i></b>. And I'm into it. AND it feels like they really prevent my skin from getting breakouts. NIP+FAB is a brand I discovered this year and I've been really loving it. I bought mine on FeelUnique and they're on sale right now!</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/Elemis-Soothing-Apricot-Toner-200ml?q=apricot+elemis&amp;q_typ=f" target="_blank">Elemis Soothing Apricot Toner</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">Another discovery from a friend's recommendation, this toner is<b> really calming and has a pleasant, inoffensive smell</b> that makes me feel really calm. It really soothes my skin and makes it feel less blushy (blush-prone. blush-easy??) Plus the vibe of the product totally gives me <b>luxury </b>vibes and it's a joy to use.</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/REN-Wake-Wonderful-Night-Time-Facial-40ml?q=ren+wake+wonderful&amp;q_typ=f" target="_blank">REN Wake Wonderful Night-Time Facial</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">I'm on my second bottle of this stuff. At first I bought it a bit begrudgingly because at the time, it was the only AHA product in the store I went to, but honestly, this stuff is amazing. I don't like how it feels on the skin which is why I don't use it enough (it's thick and a bit sticky) but OHMYGOD is it worth it. My skin feels <b>smoother </b>a day after using it.&nbsp;</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/Origins-Drink-Up-Intensive-Hydrating-Overnight-Mask-with-Avocado-and-Swiss-Glacier-Water-75ml?q=origins+overnight&amp;q_typ=f" target="_blank">Origins Drink Up Intensive Overnight Mask</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">I must've spoken about this before, right?! It's one of the best discoveries I made these past few years. This mask is intensely hydrating and very calming. It feels <b>pleasant </b>and it's actually <b>not annoying to sleep in</b>. I always apply it overnight when I need something <b>neutral and calming</b> for my skin.</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/NIPFAB-Dragons-Blood-Fix-Serum-Extreme-50ml?q=fix+extreme+nip+fab&amp;q_typ=f" target="_blank">NIP+FAB Dragon's Blood Fix Serum Extreme</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">I LOVE THIS STUFF. I don't know how, but it makes your skin plumped, really clear and perfectly colored. I used to get a lot of redness but using this really helped with irritated areas. I love this brand - I've tried 2 products and I adore both, so I can't wait to try more next year.</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/Kiehls-Creamy-Eye-Treatment-with-Avocado-14ml?q=kiehls+avocado&amp;q_typ=f" target="_blank">Kiehl's Creamy Eye Treatment with Avocado</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">I don't know if you saw my upcoming turning 30 confession at the beginning of this post (WHY GOD WHY?) but I figured it was time I started using eye cream. Sigh. So I bought this overhyped Kiehl's eye cream... And man, I'm part of the hype. This stuff is really <b>thick, smells lovely, makes my eyelids feel cooler and refreshed and even helps with hooding issues on the lids.&nbsp;</b></span></p><p style="text-align: center;"><span style="font-size: medium;"><b><br /></b></span></p><p style="text-align: center;"><span style="font-size: medium;">Those are the products I've been using in 2020 and will continue to use throughout next year.&nbsp;</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h1 style="text-align: center;"><span style="font-size: x-large;">What was your top skincare product of 2020?</span></h1>http://nothinfancyreally.blogspot.com/2020/12/a-random-girls-best-of-2020-skincare.htmlnoreply@blogger.com (Živa)0tag:blogger.com,1999:blog-2743690106034386179.post-6318979188525042445Fri, 12 Jul 2019 16:58:00 +00002019-07-14T13:38:08.169+02:00booksreadingBook review: Daisy Jones & The Six<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhZcLsSnV2iwZ0JAX3D_ltLI96YLPcZMPwVCR8-uXsazlBcfanXxGNmx0ZD543dC5pqyH3E-jlVJG70cWKHBUGoZsVFJlUbrvG5iUgAEdyl35wEWy9x3tYfXWaRNZoXOwsLZzC87mXtzZqD/s1600/daisy_jones_and_the_six_review_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1600" data-original-width="1200" height="640" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhZcLsSnV2iwZ0JAX3D_ltLI96YLPcZMPwVCR8-uXsazlBcfanXxGNmx0ZD543dC5pqyH3E-jlVJG70cWKHBUGoZsVFJlUbrvG5iUgAEdyl35wEWy9x3tYfXWaRNZoXOwsLZzC87mXtzZqD/s640/daisy_jones_and_the_six_review_2.jpg" width="480" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhPOowLsflgt3HEd-2YmmRROxX509Zc9b86LwZw3oL0YBoHYkAgvA2FAdtTvDxn6zp-JoxzfvW-3HG_tR-c0AA2-wMfJ50PFwqVHkx5up10sdTocMPbNuRrIRLBznBiaTfnOqHDtCzVBMdO/s1600/daisy_jones_and_the_six_review_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1600" data-original-width="1200" height="640" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhPOowLsflgt3HEd-2YmmRROxX509Zc9b86LwZw3oL0YBoHYkAgvA2FAdtTvDxn6zp-JoxzfvW-3HG_tR-c0AA2-wMfJ50PFwqVHkx5up10sdTocMPbNuRrIRLBznBiaTfnOqHDtCzVBMdO/s640/daisy_jones_and_the_six_review_3.jpg" width="480" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <h2 style="clear: both; text-align: center;"> Hi beautiful!</h2> <div> I've kind of gotten out of the habit of posting about books, but I recently read this beautiful story and I just had to share it with you guys! If you love heartbreaking love stories you will absolutely adore this one. It's worth it - try and give it a go.</div> <div> <br /></div> <div> Daisy Jones &amp; The Six is a story about the 70s - drugs, sex and rock'n'roll. All the characters in this book were seriously flawed which I really, really like. I've gotten a bit sick of too-perfect-to-be-real characters and I'm so excited more authors are exploring the darker side of their heroes.&nbsp;</div> <div> <br /></div> <div> <b>Here is the blurb for Daisy Jones &amp; The Six:</b></div> <blockquote class="tr_bq" style="text-align: center;"> <br /> Daisy is a girl coming of age in L.A. in the late sixties, sneaking into clubs on the Sunset Strip, sleeping with rock stars, and dreaming of singing at the Whisky a Go Go. The sex and drugs are thrilling, but it’s the rock ’n’ roll she loves most. By the time she’s twenty, her voice is getting noticed, and she has the kind of heedless beauty that makes people do crazy things.<br /> Also getting noticed is The Six, a band led by the brooding Billy Dunne. On the eve of their first tour, his girlfriend Camila finds out she’s pregnant, and with the pressure of impending fatherhood and fame, Billy goes a little wild on the road.<br /> Daisy and Billy cross paths when a producer realizes that the key to supercharged success is to put the two together. What happens next will become the stuff of legend.<br /> The making of that legend is chronicled in this riveting and unforgettable novel, written as an oral history of one of the biggest bands of the seventies. Taylor Jenkins Reid is a talented writer who takes her work to a new level with Daisy Jones &amp; The Six, brilliantly capturing a place and time in an utterly distinctive voice.</blockquote> <div style="text-align: left;"> For me, this was the standout novel of 2019 and I am so glad I finally picked it up. I'm currently reading the author's other novel, The Seven Husbands Of Evelyn Hugo, and also enjoying it a lot. My only criticism of this heartbreakingly beautiful book is that I wanted MORE! It ended up too abruptly for my liking and I just wanted more of the main characters. I'd love to know if you felt the same way in case you read this one.</div> <div style="text-align: center;"> <b><i>What's your favorite book of this summer?</i></b></div> http://nothinfancyreally.blogspot.com/2019/07/book-review-daisy-jones-six.htmlnoreply@blogger.com (Živa)0tag:blogger.com,1999:blog-2743690106034386179.post-464767661941330658Tue, 09 Jul 2019 13:07:00 +00002019-07-11T13:32:42.679+02:00catricedrugstoreessencelipglossmakeupnyxrimmelBest Drugstore Lipglosses 2019<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9gBjAI8PCT2j9scudWV_CawLJ3evAioIS5VrfQBa3cRxfHXcCOpxrv9T66S0bKWPYtjI1vJjJDksiVb3D1kcRJ-O4OqIgnGkBZ_n18afe30P3JgCrQx3RETTvc-qpUKiO-LdS0U5sCdMm/s1600/best_drugstore_lipglosses_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1600" data-original-width="1200" height="640" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9gBjAI8PCT2j9scudWV_CawLJ3evAioIS5VrfQBa3cRxfHXcCOpxrv9T66S0bKWPYtjI1vJjJDksiVb3D1kcRJ-O4OqIgnGkBZ_n18afe30P3JgCrQx3RETTvc-qpUKiO-LdS0U5sCdMm/s640/best_drugstore_lipglosses_1.jpg" width="480" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhoisLRgVmy_BAN_0xjLHmosb2o9TpxR8sfBA_2pgTBszzvIs6iQwKg4hJu-o7M8CyDmlbTY-xOdA0QlwfyswblzBffJ97Jpl88gViT-W-zSt_9-UbTZBrl6V-MQvVxhtoGUkVJSkS9lx5o/s1600/best_drugstore_lipglosses_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1200" data-original-width="1600" height="480" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhoisLRgVmy_BAN_0xjLHmosb2o9TpxR8sfBA_2pgTBszzvIs6iQwKg4hJu-o7M8CyDmlbTY-xOdA0QlwfyswblzBffJ97Jpl88gViT-W-zSt_9-UbTZBrl6V-MQvVxhtoGUkVJSkS9lx5o/s640/best_drugstore_lipglosses_3.jpg" width="640" /></a></div> <br /> <div style="text-align: center;"> <b><span style="font-size: large;">Hi beautiful!</span></b></div> <div style="text-align: center;"> <br /></div> <i>I've rediscovered my love for lipgloss in the past few months. I haven't worn it in years, I've been all about that lipstick life, but I think I've severely neglected my lipgloss addiction! Just because liquid lippies were all the rage doesn't mean I shouldn't ever wear lipgloss again - it's pretty and I love how juicy it makes my lips look. I've prepared a roundup of my drugstore favorites below!</i><br /> <i><br /></i> <br /> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Rimmel Oh My Gloss!</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> Everyone needs a red gloss in their life. It just gives a <b>sexy pop of color</b> and I love this shade of red - it's very <b>cool toned</b> which looks good on my skin. This gloss is a little bit sticky but I find it really doesn't bother me. The shade pictured here is <b>500 Ooh La La</b>. I received this product in PR but I am planning on purchasing a couple more colors. You can purchase this lipgloss <a href="https://www.notino.si/rimmel/oh-my-gloss-sijaj-za-ustnice/">here </a>for less than 5€.</div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Catrice Dewy-ful Lips</span></u></b></i></div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> This is such an amazing find! I picked it up by coincidence in my local drugstore and completely fell in love. It's<b> light, not sticky at all</b>, and actually feels like it's <b>conditioning </b>my lips, so a win all around. The shade I have is <b>060 Don't Dream It, DEW It</b>! I believe they have a couple of other shades which I will definitely be picking up. The <b>pigmentation isn't amazing</b> but I love it for the lip-balm feel - it doesn't dry out my lips at all. More information <a href="https://catrice.eu/lips/lipstick/lipsticks/catrice-cosmetics/dewy-ful-lips-conditioning-lip-butter.html">here</a>, and I believe the price was around 5€.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Catrice Prisma Lip Glaze</span></u></b></i></div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> These are SO beautiful in the tube, I would honestly just buy them to take pictures... But luckily they're very pretty as well! They're similar to the Essence Shine Shine Shine glosses in that they're a bit sticky, but beautiful all around. They also work great as <b>topcoats over a liquid lipstick</b>. I have the shade <b>050 Holy Moly</b>. More information on Catrice's website <a href="https://catrice.eu/en/lips/lip-gloss/lip-balm/catrice-cosmetics/prisma-lip-glaze-5.html">here</a>.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">NYX Butter Gloss</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> The shades I picked up are both quite neutral, and are called <b>Tiramisu </b>(the more brown one) and <b>Vanilla Cream Pie</b> (the pinker one). These glosses remind me a bit of the Dewy-ful lips as they're quite conditioning and very very pretty. They're an <b>easy, throw on shade</b> that you don't need to worry about, but need to <b>reapply </b>a bit more often. They're a little sticky, but nothing I can't handle. You can pick them up <a href="https://www.notino.si/nyx-professional-makeup/butter-gloss-sijaj-za-ustnice/">here </a>for 6,5€.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Essence Shine Shine Shine</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> The shades pictured above are <b>15 Watch Me Do</b> and <b>03 Friends of Glamour</b>. This lipgloss is that quintessential 90s <b>sticky glittery gloss</b>, so you might be asking yourself what the hell it's doing in this roundup... But I have to admit I have a soft spot for products like this. It <b>looks pretty, makes my lips appear bigger, and is the perfect product to just throw on when you're in a rush</b>. I believe the price is under 4€ as well, so it's a total bargain!</div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: left;"> That's it for this roundup! I would love to do another one in a couple of months for high-end lipglosses, but I honestly haven't picked any up yet because I just wanted to try out the drugstore offerings first. Now that I'm officially in love, it's time to try out more products!</div> <div style="text-align: center;"> <b><i>What's your favorite lipgloss?</i></b><br /> <b><i><br /></i></b> <b><i></i></b><br /> <a name='more'></a><b><i><br /></i></b><br /> <div style="text-align: center;"> <span style="font-size: large;"><b>Hej, lepotička!</b></span><br /> <span style="font-size: large;"><b><br /></b></span></div> <div style="text-align: start;"> <i>V zadnjih nekaj mesecih sem ponovno odkrila svojo ljubezen do glossov. Že leta nosim večinoma tekoče šminke, ampak to se je pred kratkim spremenilo! Čeprav obožujem tekoče šminke, sem že malo naveličana mat videza - včasih prav paše malo sijaja na ustnicah :) Zate sem pripravila povzem svojih najljubših izdelkov iz drogerije. Bonus: nobeden ne stane več kot 7€!</i></div> <div style="text-align: start;"> <i><br /></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Rimmel Oh My Gloss!</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> Se mi zdi, da prav vse potrebujemo en rdeč gloss v svojem življenju. Da ti zapeljivo barvo, tale odtenek je pa res čudovit - na mojo kožo bolj pašejo ti hladni toni. Je sicer malo lepljiv, ampak mene ne moti. Odtenek na sliki je&nbsp;<b>500 Ooh La La</b>. Se mi zdi, da ga rabim še v nekaj barvah. Kupiš ga lahko&nbsp;<a href="https://www.notino.si/rimmel/oh-my-gloss-sijaj-za-ustnice/">tule</a>&nbsp;za manj kot 5€.</div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Catrice Dewy-ful Lips</span></u></b></i></div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> Tole je bilo pa res odkritje leta! Kupila sem ga čisto po slučaju, in se čisto zaljubila! Lahek, prav nič lepljiv izdelek, pa še občutek daje, da ustnice neguje. Moj odtenek je&nbsp;<b>060 Don't Dream It, DEW It</b>! Imajo še nekaj odtenkov, ki sem jih že dodala na svoj seznam. Najboljša stvar je pa, da ustnic niti malo ne izsuši. Več informacij najdeš&nbsp;<a href="https://catrice.eu/lips/lipstick/lipsticks/catrice-cosmetics/dewy-ful-lips-conditioning-lip-butter.html">tukaj</a>.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Catrice Prisma Lip Glaze</span></u></b></i></div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> Tale gloss je pa tako lep, da bi ga kupila samo za fotke... K sreči je pa tudi super izdelek! Malo so podobni Essence Shine Shine Shine glossom, ker so rahlo lepljivi, ampak se splača! Meni so najboljši kot dodaten nanos čez šminko, saj dajo čudovit sijaj.&nbsp;Moj odtenek je&nbsp;<b>050 Holy Moly</b>. Več informacij najdeš na spletni strani Catrice&nbsp;<a href="https://catrice.eu/en/lips/lip-gloss/lip-balm/catrice-cosmetics/prisma-lip-glaze-5.html">tukaj</a>.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">NYX Butter Gloss</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> Oba odtenka, ki sem ju kupila, sta precej nevtralna. Barvi sta&nbsp;<b>Tiramisu&nbsp;</b>(bolj rjav ton) in&nbsp;<b>Vanilla Cream Pie</b>&nbsp;(bolj roza ton). Teli izdelki me spominjajo na Dewy-ful lips saj so zelo lepi na ustnicah, obenem pa tudi negujejo. Prav z lahkoto se nanesejo, moraš pa večkrat ponoviti aplikacijo.&nbsp;Majčkeno lepljivi, ampak nič groznega. Kupiš jih lahko&nbsp;&nbsp;<a href="https://www.notino.si/nyx-professional-makeup/butter-gloss-sijaj-za-ustnice/">tukaj</a>&nbsp;za&nbsp;6,5€.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Essence Shine Shine Shine</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> Odtenka na sliki sta&nbsp;<b>15 Watch Me Do</b>&nbsp;in&nbsp;<b>03 Friends of Glamour</b>. Tale lipgloss ima prav tisto formula iz leta 2000... Saj veš, ko smo vse uporabljale&nbsp;<b>lepljive, bleščičaste glosse</b>. Mogoče se sprašuješ, kaj sploh počne v tej objavi... Ampak moram priznati, da še vedno obožujem takšne izdelke. Zgleda res lepo, super je, ko se ti kam mudi, ker se ni treba obremenjevati s svinčnikom, šminko, pa še čem... Stane pa manj kot 4€, tako da je za povrh vsega super ugoden!</div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: left;"> To je vse! Z veseljem bi pripravila še eno objavo o malo dražjih izdelkih, ampak trenutno sem se osredotočila na drogerijsko ponudbo, da sem se prepričala, če so mi glossi sploh še všeč. Zdaj pa, ko sem uradno zaljubljena vanje, me čaka še kakšen nakup malo dražjih znamk... Me prav zanima razlika!</div> <div style="text-align: center;"> <b><i>Kateri je tvoj najljubši lip gloss?</i></b></div> </div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <br /></div> http://nothinfancyreally.blogspot.com/2019/07/best-drugstore-lipglosses-2019.htmlnoreply@blogger.com (Živa)0tag:blogger.com,1999:blog-2743690106034386179.post-676191424234867195Sat, 22 Jun 2019 11:04:00 +00002019-07-11T13:21:32.181+02:00budgetfragranceNotinoBest perfumes for summer 2019<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhsBigIYZmhQ1kicziOjuHHMaiHxIxbOTtMnSdfZ9QkHH_zMROsd_5zaJXsnZRPhUbHJvBfongA0xknzySawviDLNNX6e_v8a5MIhUPiNp7TrQJ1orCLLE1qse3P4Gw1dCwdu-VpKuMC9CB/s1600/best_summer_2019_perfumes_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1600" data-original-width="1200" height="640" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhsBigIYZmhQ1kicziOjuHHMaiHxIxbOTtMnSdfZ9QkHH_zMROsd_5zaJXsnZRPhUbHJvBfongA0xknzySawviDLNNX6e_v8a5MIhUPiNp7TrQJ1orCLLE1qse3P4Gw1dCwdu-VpKuMC9CB/s640/best_summer_2019_perfumes_1.jpg" width="480" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg7U_zun9pHHZgtsIyofXJ-tdphMQFwLgHWWHMVW1Ag4SwyQ7d_wQeUjjfbWKTnu2n-42QJd6RMCVtdXOhnsI72q3o6xOkkN6bWcnbghhVb6P3ht0apFhAd74xMVMOlD1EK8CXofIaKq3Qo/s1600/best_summer_2019_perfumes_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1200" data-original-width="1600" height="480" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg7U_zun9pHHZgtsIyofXJ-tdphMQFwLgHWWHMVW1Ag4SwyQ7d_wQeUjjfbWKTnu2n-42QJd6RMCVtdXOhnsI72q3o6xOkkN6bWcnbghhVb6P3ht0apFhAd74xMVMOlD1EK8CXofIaKq3Qo/s640/best_summer_2019_perfumes_3.jpg" width="640" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <span style="font-size: large;"><b>Hi beautiful!</b></span></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> <i>It's been a hot minute since I've last posted, but I think the blogging bug has hit me again because I recently spent a weekend taking photos for new posts and imagining all the things I want to do with this space. I can't promise I'm back officially, but I will try to post more often and show you more of the things I've been loving. I think back in 2017 blogging became a chore for me, and I'm trying very very hard to make it fun for me again.</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>I adore perfume and I've always loved posting about my yummy favorites, so I thought it would be the perfect way to come back and share some of my summer favorites! Without further ado, let's just get into the scents that have been making my summer amazing...</i></div> <div class="separator" style="clear: both; text-align: center;"> <span style="font-size: large;"><br /></span></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://www.notino.si/jennifer-lopez/glow-by-jlo-toaletna-voda-za-zenske/"><span style="font-size: large;"><b><i>Glow by JLo EDT</i></b></span></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> This is, hands down, the perfume I think everybody needs. If you just want to smell <b>fresh, soapy, and like you came right out of the shower</b>, you've found the perfect perfume. It always makes me feel so fresh and ready to start my day, and I love <b>layering</b> it with other scents as well (it works so well with floral perfumes). Plus, it's an absolute <b>bargain</b>. Trust me, you'll be glad you got this one! It's less than 30€ for the big bottle.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/dolce-gabbana/light-blue-eau-intense-parfumska-voda-za-zenske/">Dolce &amp; Gabbana Light Blue Eau Intense</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Take a stroll in Ljubljana during the summer and you're guaranteed to smell Light Blue at least three times. I always liked the <b>sharp, citrusy scent</b> of this perfume but I hate smelling like everybody else, which is why I decided to pick up this intense version of the scent. It's even better in my opinion! Just like Glow, it makes you feel fresh, with the added bonus of that <b>sexy, expensive citrus</b>. A staple in my summer fragrance wardrobe for sure. The price ranges from 45€ for a small bottle but it's so worth it.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/armani/acqua-di-gioia-parfumska-voda-za-zenske/">Armani Acqua di Gioia EDP</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> I think this one has had a makeover, but I still have last year's bottle (the new one looks so sophisticated!) I always say this perfume is my <b>secret weapon</b> - and my <b>signature scent</b>. It's just such a <b>yummy, sexy watermelon scent</b> that just makes your mouth water and it's the perfect pick for summer! I also love the flankers that came out last year, but when I was trying them out, I always came back to this one - it's just soooo perfect!! Prices range from 39€+.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/roberto-cavalli/roberto-cavalli-parfumska-voda-za-zenske/">Roberto Cavalli Roberto Cavalli EDP</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> This is another one of those secret weapons I love, and I love wearing it for date night. It's sweet, sexy and beachy and I just adore it - plus the sillage is great and it lasts for ages. This one's definitely a compliment getter because people will smell it on you, and love it. I also love it for vacations, so if you're jetting off someplace nice: 1. I'm jealous 2. give this one a go at the Duty Free. I paid around 40€ for the biggest bottle on Notino which is just perfect as well.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I hope you enjoyed my foray into the best summer scents for this year! I'm sure I'll have another post like this coming soon - you know me, I'm just a perfume addict... and I could help it, but I don't want to!</div> <div class="separator" style="clear: both; text-align: center;"> <b><i>What is your favorite perfume for the hot summer months?</i></b></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><br /></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <b><i></i></b></div> <a name='more'></a><b><i><br /></i></b><br /> <div class="separator" style="clear: both; text-align: center;"> <b><span style="font-size: large;">Hej, lepotička!</span></b></div> <div class="separator" style="clear: both; text-align: center;"> <b><span style="font-size: large;"><i><br /></i></span></b></div> <div class="separator" style="clear: both; text-align: left;"> <i>Vem, da že dolgo nisem objavila ničesar, ampak pred nekaj tedni me je očitno spet pičila blogerska muha, saj sem cel vikend pripravljala fotke za nove objave. Ne morem obljubiti, da sem uradno nazaj, bom pa poskušala objavljati večkrat in ti pokazati več stvari, ki me trenutno navdušujejo. Mislim, da sem leta 2017 postala preobremenjena s službo, bloganje je postalo naloga in veselje do pisanja je izginilo.</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>Obožujem parfume, še raje pa pišem o njih. Danes s tabo delim nekaj svojih poletnih favoritov. Pa poglejmo, kaj se te mesece znajde na moji polici s parfumi...</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://www.notino.si/jennifer-lopez/glow-by-jlo-toaletna-voda-za-zenske/"><span style="font-size: large;"><b><i>Glow by JLo EDT</i></b></span></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Po mojem mnenju dišava, ki jo potrebuješ v svoji zbirki. Če želiš dišati&nbsp;<b>sveže, milnato, in kot da si ravnokar izpod tuša</b>, si našla popoln parfum. Z njim se vedno počutim sveže, pripravi me na nov dan, obenem pa je super tudi za&nbsp;<b>kombiniranje z drugimi vonji</b>&nbsp;(krasno gre skupaj s cvetličnimi parfumi). Poleg tega je pa še&nbsp;<b>zelo ugoden</b>. Verjemi mi, tale je res super! Stane pa manj kot 30€ za 100 ml.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/dolce-gabbana/light-blue-eau-intense-parfumska-voda-za-zenske/">Dolce &amp; Gabbana Light Blue Eau Intense</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Če se poleti sprehodiš po Ljubljani, grem stavit, da boš vsaj trikrat zavohala slavni Light Blue. Meni je bil vedno všeč njegov&nbsp;<b>oster, citrusen vonj</b>&nbsp;ampak ne maram dišati kot vsi ostali, zato sem zase raje izbrala tole intense verzijo. Po mojem mnenju je še boljša! Tako kot Glow je Light Blue Eau Intense zelo svež vonj, obenem pa ima še prednost&nbsp;<b>seksi svežega citrusa</b>. Definitivno nujen del moje poletne zbirke. Cene se gibajo od 45€ za manjšo stekleničko, in jaz mislim, da je parfum vreden vsakega evra!</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/armani/acqua-di-gioia-parfumska-voda-za-zenske/">Armani Acqua di Gioia EDP</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Mislim, da je tale parfum imel pred kratkim makeover, jaz imam pa še vedno staro stekleničko, čeprav se bližam koncu. Je pa nova verzija čudovita! Vedno pravim, da je tale vonj moje&nbsp;<b>skrivno orožje</b>&nbsp;- in pa tudi moj&nbsp;<b>signature vonj</b>. Res je&nbsp;<b>slasten, zapeljiv vonj po lubenici</b>, popoln za poletje in super svež! Všeč so mi tudi verzije, ki so izšle lani (Sun, Air di Gioia), ampak se kar naprej vračam k temu - prav popoln je! To je že moja druga 100 ml steklenička, pa sem spet čisto pri koncu... Cene gredo pa od 39€ naprej.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/roberto-cavalli/roberto-cavalli-parfumska-voda-za-zenske/">Roberto Cavalli Roberto Cavalli EDP</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Še eno od tistih skrivnih orožij, ki jih obožujem. Tale je popoln za date night. Sladek, zapeljiv in primeren za vroče dneve - pa še dolgo se obdrži, in garantirano ga bodo zavohali ljudje okrog tebe. Tale parfum dobiva komplimente vsakič, ko ga uporabim. Meni je najbolj všeč za na počitnice, tako da, če se kam odpravljaš: 1. sem ljubosumna nate 2. preizkusi tale vonj v Duty Free. Jaz sem plačala okrog 40€ na Notinu.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> Upam, da ti je objava o poletnih parfumih pomagala! Prav gotovo bo sledila še kakšna, saj veš, malo sem obsedena s parfumi...&nbsp;</div> <div class="separator" style="clear: both;"> </div> <div class="separator" style="clear: both; text-align: center;"> <b><i>Kateri je tvoj najljubši poletni parfum?</i></b></div> http://nothinfancyreally.blogspot.com/2019/06/best-perfumes-for-summer-2019.htmlnoreply@blogger.com (Živa)0tag:blogger.com,1999:blog-2743690106034386179.post-954622832433705383Tue, 18 Jul 2017 11:02:00 +00002017-07-18T13:02:54.620+02:00acnecliniquehigh endla roche posayoriginsskincaresunday rileyCurrent Skincare Favorites<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi2Jh40bNeRdfGRzC1QzPkdDi2UWl8XZdeY-RWo2HYMB7XzA7catGCk0AzHS4dX-k0OXiMdgvYhir5XpU0F0DHZib0Bg8-UVP68OsnUwOO_DzBqGUmCR9fi9QeKfYn8qeW80xsAojPyKrHO/s1600/IMG_0649.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="900" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi2Jh40bNeRdfGRzC1QzPkdDi2UWl8XZdeY-RWo2HYMB7XzA7catGCk0AzHS4dX-k0OXiMdgvYhir5XpU0F0DHZib0Bg8-UVP68OsnUwOO_DzBqGUmCR9fi9QeKfYn8qeW80xsAojPyKrHO/s1600/IMG_0649.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgNMfQqEJmz2BDnDCz0WNVmCPjY9cB0RuX8IxPaQkzCgIijc-I8A-NEWIpItujlPfuXQI1mX868ryBuI3NSV924fMlsg9OjLvABAZ1SUTTjP2zo0_CYmhR_8WJhSAgfdZKwk7dZz_zQpfAE/s1600/IMG_0653.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="400" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgNMfQqEJmz2BDnDCz0WNVmCPjY9cB0RuX8IxPaQkzCgIijc-I8A-NEWIpItujlPfuXQI1mX868ryBuI3NSV924fMlsg9OjLvABAZ1SUTTjP2zo0_CYmhR_8WJhSAgfdZKwk7dZz_zQpfAE/s1600/IMG_0653.JPG" /></a></div> <div class="separator" style="clear: both; text-align: center;"> </div> <h2 style="text-align: center;"> Hello my lovelies!</h2> <br /> <div class="separator" style="clear: both; text-align: left;"> <i>It's been a long time since you've seen me post around here, but that's hopefully going to change in the coming weeks. I had to take a little work-related break, but I'm back with so many new beauty goodies and so many things I want to talk about. I can't wait to tell you what I've been up to.</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>Today I wanted to do a post on skincare that has been working for me lately, and might hopefully help you out a little too. I also wanted to add I've been slowly transitioning from a mostly drugstore regimen to something a bit more high end. I feel like I'm a bit older now and I can finally afford to spend a bit more on my beauty regimen, so why not?</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>I'm still struggling with problematic skin which is honestly so annoying. It should be over once you turn twenty-five, but it seems like it's worse than it has been in a while. But these products really help my skin, and when I use them religiously, my complexion looks so much better.</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>So let's just get started with the products I've been loving lately!</i></div> <!-- COLLECTIVE WIDGET CODE START --> <div class="shopsense-widget" style="text-align:center" data-options="%7B%22widgetId%22%3A%22596de14cdd4edb3a166ce176%22%2C%22version%22%3A1%2C%22pid%22%3A%22uid4004-30511498-73%22%2C%22size%22%3A120%2C%22columns%22%3A5%2C%22rows%22%3A1%2C%22url%22%3A%22https%3A%2F%2Fapi.shopstyle.com%2Fapi%2Fv2%22%2C%22iframeHeight%22%3A195%2C%22iframeWidth%22%3A735%7D"> <script> !function(doc,s,id){ var e, p, cb; if(!doc.getElementById(id)) { e = doc.createElement(s); e.id = id; cb = new Date().getTime().toString(); p = '//shopsensewidget.shopstyle.com/widget-script.js?cb=1500375679470?cb=' + cb; e.src = p; doc.body.appendChild(e); } if(typeof window.ss_shopsense === 'object'){ if(doc.readyState === 'complete'){ window.ss_shopsense.init(); } } }(document, 'script', 'shopsensewidget-script'); </script> <iframe src="//shopsensewidget.shopstyle.com/#/?options=%7B%22widgetId%22%3A%22596de14cdd4edb3a166ce176%22%2C%22version%22%3A1%2C%22pid%22%3A%22uid4004-30511498-73%22%2C%22size%22%3A120%2C%22columns%22%3A5%2C%22rows%22%3A1%2C%22url%22%3A%22https%3A%2F%2Fapi.shopstyle.com%2Fapi%2Fv2%22%2C%22iframeHeight%22%3A195%2C%22iframeWidth%22%3A735%7D" height="195px" width="735px" seamless style="border: 0;"> </iframe> </div> <!-- COLLECTIVE WIDGET CODE END --> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <h4 style="clear: both; text-align: center;"> Origins GinZing Eye Cream</h4> <div class="separator" style="clear: both; text-align: left;"> I remember years and years ago, when I used to be obsessed with Origins but there was just no way for me to get it. Fast forward to today and this cream is one of my favorite products. YAY! I finally got my hands on it. It's scented slightly like <b>sunscreen </b>and it feels so pleasant and <b>cooling </b>on my eyes. I've been struggling with <b>itchy/dry</b> undereyes and this has really been helping a lot. I got it from <a href="http://eu.feelunique.com/p/Origins-GinZing-Refreshing-Eye-Cream-to-Brighten-and-Depuff-15ml">FeelUnique </a>for around 22€.</div> <h4 style="clear: both; text-align: center;"> Sunday Riley Good Genes</h4> <div class="separator" style="clear: both; text-align: left;"> You know all the good stuff people say about this product? Well, it's all true. I ADORE it. It's just one of those moisturizers that <b>makes a difference overnight</b>, and I can always count on it to make my skin beautiful by the time I wake up. I seriously love it. Good Genes is a <b>lactic acid treatment </b>and it honestly rejuvenates and refreshes my skin in a matter of hours. Whether it be breakouts, dryness or itchiness, it takes care of it all. SO worth the price, although repurchasing it might make my wallet cry. I got it from <a href="https://www.net-a-porter.com/si/en/product/459656/sunday_riley/good-genes-treatment--30ml">NAP </a>for around 100€.</div> <h4 style="clear: both; text-align: center;"> Sunday Riley UFO Oil</h4> <div class="separator" style="clear: both; text-align: left;"> This is a newer addition to my skincare routine and I've only been using a couple of times per week, but I feel like it moisturizes my skin like nothing else. I've discovered my skin is really <b>dehydrated </b>despite being so oily (or maybe because of it?) and this product makes it look <b>plump </b>and refreshed, which I just love. I haven't tried any of the other Sunday Riley oils, and I do have to say, the <b>tint </b>they put in them really puts me off. I seriously look like a Martian with this on... But it helps me break out less, and around that time of the month, it's a lifesaver. You can get it <a href="https://www.net-a-porter.com/si/en/product/844664?resType=single&amp;keywords=ufo&amp;termUsed=ufo&amp;enableAjaxRequest=false">here </a>for around 90€.</div> <h4 style="clear: both; text-align: center;"> La Roche Posay Effaclar Micellar Water</h4> <div class="separator" style="clear: both; text-align: left;"> I love this brand and I love their Effaclar range, so this micellar water is another win for me. I love the <b>big packaging</b>, it's <b>gentle </b>but efficient, and <b>inexpensive</b>. I don't think I've used a LRP product I didn't love (except for Duo&nbsp;+, but I need to try that again). I would really recommend this. You can get it <a href="http://www.feelunique.com/p/La-Roche-Posay-Effaclar-Ultra-Purifying-Micellar-Water-400ml">here </a>or in your local pharmacy for around 12€.</div> <h4 style="text-align: center;"> Clinique Anti-Blemish Solutions Clininal Clearing Gel</h4> <div style="text-align: left;"> Okay, this might be a bit controversial. It's heavily <b>alcoholic </b>and you can smell it, but the thing is, it works so well. <b>It dries out my breakouts without irritating my skin in a matter of hours</b>, maybe one or two. It helps so much when I have a problematic area, and I can't imagine not using it. Similar to Grease Lightning by Lush but SO much faster. I love it. It's pricy as far as I can remember, around 40€, but I love it.</div> <h4 style="text-align: center;"> Clinique Anti-Blemish Solutions Blemish&nbsp;+ Line Correcting Serum</h4> <div style="text-align: left;"> I've really been enjoying this product as well. It's not as alcoholic and <b>feels pleasant and hydrating on the skin but still like it's actually doing something</b>. This was pricy as well (I feel like it cost about 55€, can't remember), and while I probably won't repurchase it, I've been really enjoying it.</div> <div style="text-align: left;"> <br /></div> <div style="text-align: center;"> These items have been helping my skin a lot, and I've really been loving adding them to my skincare routine!</div> <div style="text-align: center;"> <b><i>What's your favorite skincare product at the moment?</i></b></div> http://nothinfancyreally.blogspot.com/2017/07/current-skincare-favorites.htmlnoreply@blogger.com (Živa)2tag:blogger.com,1999:blog-2743690106034386179.post-3721398627703242679Thu, 15 Jun 2017 11:56:00 +00002017-06-15T13:56:50.319+02:00bloggingpersonalrandomWhy it's okay to take a break sometimes<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgELGJxxM-fvfzd4xIshWRX6Xk5sh7aSMrEX4vapCrXvZQyjDRKQfNR5qsYlLaBIxZHVgwEUkHMERzYo6Qm0wusi85wZiHiQV-kcZgHEE83SexstPlBpS5YHXBBdQBLVGQfAjQSWTY4R8EQ/s1600/break1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="900" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgELGJxxM-fvfzd4xIshWRX6Xk5sh7aSMrEX4vapCrXvZQyjDRKQfNR5qsYlLaBIxZHVgwEUkHMERzYo6Qm0wusi85wZiHiQV-kcZgHEE83SexstPlBpS5YHXBBdQBLVGQfAjQSWTY4R8EQ/s1600/break1.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiJcfUlTkQ9CdBkA4Ig7bjLtdyZe7MESLLqBeJUdGYJ4FL-rhwxaaNS7ugYJA3drDNs4N9xKZ7XFEM1lEtS3g1KAwsCGBJ9zIyma9yTJkkGDvfK9dGZP5TTuXKmfcpNXja7lcxsxcBubvtY/s1600/break2.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="400" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiJcfUlTkQ9CdBkA4Ig7bjLtdyZe7MESLLqBeJUdGYJ4FL-rhwxaaNS7ugYJA3drDNs4N9xKZ7XFEM1lEtS3g1KAwsCGBJ9zIyma9yTJkkGDvfK9dGZP5TTuXKmfcpNXja7lcxsxcBubvtY/s1600/break2.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj4Jo_zeRP6neOvrNZV-uw5z2EuOnNea3DshpbBMTKmnzEIxPJbhtGVoUTwJTJ0S06NhyHLv-cuDY0YD2hWrA5ecOfOPUZfNFx5WqEUgTCrqB6O4FSWlzZyOIpHmKAgQQpJKbKtnqxrOyF1/s1600/break3.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="400" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj4Jo_zeRP6neOvrNZV-uw5z2EuOnNea3DshpbBMTKmnzEIxPJbhtGVoUTwJTJ0S06NhyHLv-cuDY0YD2hWrA5ecOfOPUZfNFx5WqEUgTCrqB6O4FSWlzZyOIpHmKAgQQpJKbKtnqxrOyF1/s1600/break3.JPG" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> </div> <ol> <li>So you can stop and smell the roses</li> <li>For the scent of fresh coffee in the morning, and a to-do list that makes you feel excited you're alive</li> <li>To feel your fingers brush your pet's fur, and see them lean against your hand</li> <li>So you can focus on your career and achieve acomplishments you were too scared to even dream of</li> <li>Because you know you will break if you don't</li> <li>Knowing that the right people, the best people, will wait for you while you put yourself back together</li> <li>So you can come back with your senses renewed, full of enthusiasm and excitement for the projects that lay ahead</li> <li>Because a break will clear your mind, and renew all those ideas you've been too afraid to make a reality</li> <li>Your dreams will become projects, and your projects will become dreams</li> <li>And you will make everything you've worked for become a reality, you will be the best version of you you've ever been, and you will be ready for this new chapter of your life.</li> </ol> <br /><div> <b>I hope you'll crack open a new spine, and enter this new story. I'll hold your hand.</b></div> <div> <b>Welcome back, Nothin' Fancy. Really.</b></div> <br /> <br />http://nothinfancyreally.blogspot.com/2017/06/why-its-okay-to-take-break-sometimes.htmlnoreply@blogger.com (Živa)2tag:blogger.com,1999:blog-2743690106034386179.post-7243227735351131128Thu, 19 Jan 2017 11:18:00 +00002017-01-19T12:18:23.726+01:00cartierchaneldrugstorefragrancehigh endperfumeterry de gunzburgthe body shopwinterCurrent Favorite Winter Scents<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjDhMsqpVyYKjpuHR6X9mTfQN32wGP0x08p3SIqH2QeGxmbn4AJzYvIjjh2kB6vaqoHHchdOfeND77snTspdft2BXBMqX5_Z8QpY-CoZquejr_yNvDbD3hutJze70S0540bK8o-nkugBPZ9/s1600/current_favorite_winter_perfumes_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjDhMsqpVyYKjpuHR6X9mTfQN32wGP0x08p3SIqH2QeGxmbn4AJzYvIjjh2kB6vaqoHHchdOfeND77snTspdft2BXBMqX5_Z8QpY-CoZquejr_yNvDbD3hutJze70S0540bK8o-nkugBPZ9/s1600/current_favorite_winter_perfumes_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjrAwhlzm-Oq2aORgEAYrVCpaVx4GETvVSAvBkdBoSLk8Cfv_D6cUzAF8-YowrJrtpw6LKMjx1MyKMAQaI6k4urJ7273Ui-4Pwq-jlKPVx8tke_glNuxdecQXzqURvnS-FPMKEQ72L7BExZ/s1600/current_favorite_winter_perfumes_2.png" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjrAwhlzm-Oq2aORgEAYrVCpaVx4GETvVSAvBkdBoSLk8Cfv_D6cUzAF8-YowrJrtpw6LKMjx1MyKMAQaI6k4urJ7273Ui-4Pwq-jlKPVx8tke_glNuxdecQXzqURvnS-FPMKEQ72L7BExZ/s1600/current_favorite_winter_perfumes_2.png" /></a></div> <h2 style="text-align: center;"> You know I'm a huge fragrance addict...&nbsp;</h2> <div> I purchased a few new scents and discovered some old favorites this winter season, and I wanted to do a little roundup of fragrances that have made my list of favorites lately. Let's see...</div> <h3 style="text-align: center;"> Cartier Goutte de Rose EDT</h3> <div> A beautiful <b>sweet rose</b> fragrance I've falled head over heels in love with. I've been wearing this all the time for a year now, so much so it's almost becoming my signature scent. It has good lasting power, moderate sillage and suits me perfectly. It's not the old lady rose I'm used to, it's <b>fresher </b>and sweeter. Beautiful, and I'd highly recommed sampling this beauty - I know it wouldn't be my first pick from the Cartier counter, but I'm so glad I gave it a go! It has rose, woodsy notes, vanilla and amber mixed in the juice.</div> <h3 style="text-align: center;"> The Body Shop Vineyard Peach Body Mist</h3> <div> Bit of a random find, but if you like layering your fragrances, adding a <b>peach </b>note from this body spray will work so well! I adore this, it's <b>weak </b>but has good sillage so you have to <b>reapply it often</b>. But the scent... It's the <b>freshest, juiciest peach</b> ever, a note I've been struggling to find in my perfumes and can only get from this particular body mist. I just love it! And a bonus - I picked it up for 3.50 pounds in TBS' annual sale.</div> <h3 style="text-align: center;"> Chanel Coco Mademoiselle EDP</h3> <div> A recent purchase I've grown to love. Initially I wasn't a fan of this scent, but I feel like it suits me well now that I'm in my (gasp) mid-twenties. It's a very <b>pretty white floral with a lot of citrus, vanilla and rose</b>. I wish it didn't have the <b>patchouli </b>note, but I've learned to live with it. Average sillage and lasting power. Perfect for a more ladylike scent, if you've grown out your sweet and fruity perfumes, this is one to try.</div> <h3 style="text-align: center;"> Terry De Gunzburg Rêve Opulent</h3> <div> I've been wanting a Terry fragrance for ages now, and I managed to sample them all when I was in London.&nbsp;Rêve Opulent is the definite winner for me. <b>Citrus, vanilla and white florals - sweet, fresh and a little bit sexy</b>. I just adore it, though I do <b>wish it had better lasting power</b>, my skin seems to just drink it up. Otherwise it would be a firm favorite because that scent is just stunning. Would work perfectly in the warmer months.</div> <div> <br /></div> <div> I'd love to know if you have any of these scents or if any of them catch your fancy. My favorite scent right now is definitely the Terry one, it's just so perfect for me.</div> <div style="text-align: center;"> <b><i>What fragrance are you wearing today?</i></b></div> http://nothinfancyreally.blogspot.com/2017/01/current-favorite-winter-scents.htmlnoreply@blogger.com (Živa)4tag:blogger.com,1999:blog-2743690106034386179.post-351562167870013856Mon, 02 Jan 2017 14:23:00 +00002017-01-02T15:23:53.571+01:00candlehome decoryankee candleJanuary 2017 Yankee Candle Haul<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3JYb1CcBkyCEkszpBZ-t1-YcL7p3l7_AYbzydEKMAFxjJDqoo8CjVKsPC8C5LY8IwWkgrh6UUmns-7nondZwr9zKBGp9yTh7lvB6LnpVlBXVyBRC8LfKK3ryiRsrDW8_OABYwZjSI5C5R/s1600/january_2017_yankee_candle_haul_1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3JYb1CcBkyCEkszpBZ-t1-YcL7p3l7_AYbzydEKMAFxjJDqoo8CjVKsPC8C5LY8IwWkgrh6UUmns-7nondZwr9zKBGp9yTh7lvB6LnpVlBXVyBRC8LfKK3ryiRsrDW8_OABYwZjSI5C5R/s1600/january_2017_yankee_candle_haul_1.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9eX1HJ-Jjl4Um2vCLtbDJIPGAK98FdhS9xhOQL5oT57gnv8XPCbgJ2nqp6iYhHgAx7riYt0gWqaD0MNHgTG9IWDG-nTdZZsnDq2CyS3_2PIKJgvJWPGEBrmc-LHlSKJCIbGhZ3HZvinRV/s1600/january_2017_yankee_candle_haul_2.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9eX1HJ-Jjl4Um2vCLtbDJIPGAK98FdhS9xhOQL5oT57gnv8XPCbgJ2nqp6iYhHgAx7riYt0gWqaD0MNHgTG9IWDG-nTdZZsnDq2CyS3_2PIKJgvJWPGEBrmc-LHlSKJCIbGhZ3HZvinRV/s1600/january_2017_yankee_candle_haul_2.JPG" /></a></div> <h2 style="clear: both; text-align: center;"> Happy 2017!</h2> <div> What better way to kick off the year than with a Yankee Candle haul? We all know I'm a little bit obsessed with their candles, and I love talking about the scents I'm trying every month. Having 3 pets, we always have candles burning since they cats are indoor pets and I hate the smell of cat litter. Let's see which scents I purchased this month.</div> <h3 style="text-align: center;"> YC Angel's Wings</h3> <div> I never really noticed this scent in stores, but I picked it up at random and gave it a sniff, and it's a beautiful, <b>sweet </b>scent. The notes are spun <b>sugar</b>, flower <b>petals </b>and <b>vanilla</b>, and they make for a perfect soft, sweet and calming scent that I love for my bedroom. If you'd like something sweet but similar to Soft Cotton, give this a go. Available <a href="http://www.yankeecandle.co.uk/product/angels-wings/_/R-1306396E112">here</a>, but currently sold out, and <a href="http://yankeecandle.si/catalogsearch/result/?q=angel%27s+wings">here </a>for Slovenian customers. The prices range from 20-27€.</div> <h3 style="text-align: center;"> YC All Is Bright</h3> <div> I believe this is part of the NY collection, though it doesn't smell at all wintery to me. It's <b>musky </b>and citrusy. With notes of redcurrant, <b>grapefruit </b>and musk, it's almost early spring-ish, more so than wintery, at least to my nose. I really like it though, it's refreshing but calming at the same time. Available <a href="http://www.yankeecandle.co.uk/product/all-is-bright/_/R-1513534E112">here </a>and <a href="http://yankeecandle.si/catalogsearch/result/?q=all+is+bright">here</a>.</div> <h3 style="text-align: center;"> YC Red Apple Wreath</h3> <div> I love <b>apple </b>notes in my candles. There's something about that tart <b>sweetness </b>that I just adore. This one is almost like a pie with <b>cloves</b>, apples, brown <b>sugar</b>, vanilla, maple syrup and vanilla. So yummy and so lovely. I'd really recommend it, it's one of my favorite apple scents. Available <a href="http://www.yankeecandle.co.uk/product/red-apple-wreath/_/R-1120699E112">here </a>and <a href="http://yankeecandle.si/catalogsearch/result/?q=Red+Apple+Wreath">here</a>.</div> <h3 style="text-align: center;"> YC Cinnamon Stick</h3> <div> I believe I've had this one before, if not, I had Home Sweet Home which is a very similar scent. Aside from cinnamon it also has bay leaf, clove and cedarwood, and it's a very homey, <b>sweet and spicy </b>scent. This one also lasts a long time, which I love. You can purchase it <a href="http://www.yankeecandle.co.uk/product/cinnamon-stick/_/R-1055975E112">here </a>or <a href="http://yankeecandle.si/catalogsearch/result/?q=Cinnamon+Stick">here</a>.</div> <div> <br /></div> <div> There we go, my latest YC haul. I'd love to try out some new candles this year. I've been eyeing some Woodwick scents in a local store which I really should try out soon.&nbsp;</div> <div style="text-align: center;"> <i><b>What's your favorite candle brand?</b></i></div> <br />http://nothinfancyreally.blogspot.com/2017/01/january-2017-yankee-candle-haul.htmlnoreply@blogger.com (Živa)10tag:blogger.com,1999:blog-2743690106034386179.post-1575462453249786105Tue, 06 Dec 2016 21:43:00 +00002016-12-06T22:43:37.873+01:00anastasiaBECCAblushcharlotte tilburycult beautyeyebrowshaulhigh endhighlighterlipstickmakeupshoppingskincaresunday rileyCult Beauty December 2016 Haul<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUbx3Abh1pDl0h5bGBDKWLfNjJSMFQWIwaXUCtjaRLpXQz_GP6zDoDQRDvYzVaJNT1dBunMOYx4I8EL3iWY7cOBDcqeM4IGND1mCjr-Kk4G92_-dH_Mw11u9UYnC23LGwc5vl1p1VPAR_g/s1600/cult_beauty_haul_december_2016_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUbx3Abh1pDl0h5bGBDKWLfNjJSMFQWIwaXUCtjaRLpXQz_GP6zDoDQRDvYzVaJNT1dBunMOYx4I8EL3iWY7cOBDcqeM4IGND1mCjr-Kk4G92_-dH_Mw11u9UYnC23LGwc5vl1p1VPAR_g/s1600/cult_beauty_haul_december_2016_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgO05kDPhzyk46xP4QEklAZYwZiUgNOAQwlpdTtp6desYLC5KTGirRO4ymwEePfdfLCBE2YhjlVZSVewp3Hz5m36RTzpAIu4SJyVjcaHbCY8diJm76xij68ewCO_IjGIuhbVor7ic6K8wxp/s1600/cult_beauty_haul_december_2016_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgO05kDPhzyk46xP4QEklAZYwZiUgNOAQwlpdTtp6desYLC5KTGirRO4ymwEePfdfLCBE2YhjlVZSVewp3Hz5m36RTzpAIu4SJyVjcaHbCY8diJm76xij68ewCO_IjGIuhbVor7ic6K8wxp/s1600/cult_beauty_haul_december_2016_2.jpg" /></a></div> <h3 style="clear: both; text-align: center;"> Because apparently, I don't shop enough...</h3> I spent a bit too much money on Cult Beauty the other day and I wanted to share my picks with you. I got the package yesterday and I haven't tried most of it yet, but at least I can share my first impressions.<br /> <h4 style="text-align: center;"> Becca Champagne Pop Highlighter</h4> Did you have any doubts about me picking this up? Of course I had to get this gorgeous <b>golden</b>, <b>shimmery </b>highlighter. I'm excited to use it - upon first swatch it's incredibly pigmented. Available <a href="https://www.cultbeauty.co.uk/becca-jaclyn-hill-shimmering-skin-perfector-pressed-champagne-pop.html?ref=homepage#clktrack&amp;type=product&amp;list=best-selling&amp;rk=1">here </a>for&nbsp;£32.<br /> <h4 style="text-align: center;"> Becca Luminous Blush in Foxglove</h4> <br /> I haven't heard too much hype about these blushes, but I absolutely adore a <b>luminous finish on my cheeks</b> and this shade was calling my name. A beautiful <b>deep pink</b> that I'm really excited to start using. Available <a href="https://www.cultbeauty.co.uk/becca-shimmering-skin-perfector-luminous-blush.html#rk=1&amp;w=foxglove&amp;clktrack&amp;type=product&amp;list=search">here&nbsp;</a>&nbsp;for&nbsp;£27.<br /> <h4 style="text-align: center;"> Charlotte Tilbury Matte Revolution Lipstick in Bond Girl</h4> I mean, no makeup junkie's collection is complete without a CT lipstick, right? I love the shade Bond Girl, it's a <b>brown with reddish undertones</b> that I think will work well on my skintone. The packaging is luxurious and lovely as well. Available <a href="https://www.cultbeauty.co.uk/charlotte-tilbury-matte-revolution.html">here </a>for&nbsp;£23.<br /> <h4 style="text-align: center;"> Anastasia Brow Wiz in Chocolate</h4> A repurchase after several months of trying different stuff and finally deciding nothing can compare to my dear Brow Wiz. The shade is perfect, my only qualm with this product is, <b>I go through it really fast</b>. Available <a href="https://www.cultbeauty.co.uk/anastasia-beverly-hills-brow-wiz.html">here </a>for&nbsp;£15.50.<br /> <h4 style="text-align: center;"> Sunday Riley Good Genes</h4> I had this stroke of genius and decided I absolutely MUST replace all my skincare with Sunday Riley products. Upon placing them all in my shopping bag I quickly deduced I'm not a billionaire yet, so I can't afford to revamp my whole skincare in one go... But I did pick up Good Genes and have been loving it so far. It's quite <b>thick </b>and I <b>don't love the scent</b>, but you can feel it working. Available <a href="https://www.cultbeauty.co.uk/sunday-riley-good-genes.html">here </a>for an extortionate&nbsp;£85. Why does no one mention the <b>stunning packaging</b> on this? It's perfect.<br /> <br /> I know I've been posting tons of hauls lately and I promise I'll do some reviews soon as well... I've just been shopping a lot!<br /> <div style="text-align: center;"> <b><i>What's your last beauty buy?</i></b></div> http://nothinfancyreally.blogspot.com/2016/12/cult-beauty-december-2016-haul.htmlnoreply@blogger.com (Živa)6tag:blogger.com,1999:blog-2743690106034386179.post-5294131564915053391Sat, 26 Nov 2016 13:13:00 +00002016-11-26T14:13:41.680+01:00home decorinterior designlifestyleMini Apartment Tour<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlF2qfn9zuxxYN9nYsFqYtRMSMX2NA33UrMwKnymyi_qdhfG9AGu-c-obDxxtcmcmbGYWASoqvDVgE3hivz58PybPRC_rxFoUIa7eDqDBdImHCeYD-PiNQn1vozgWn2ly4GeaSSksqT2wQ/s1600/apartment1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlF2qfn9zuxxYN9nYsFqYtRMSMX2NA33UrMwKnymyi_qdhfG9AGu-c-obDxxtcmcmbGYWASoqvDVgE3hivz58PybPRC_rxFoUIa7eDqDBdImHCeYD-PiNQn1vozgWn2ly4GeaSSksqT2wQ/s1600/apartment1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEilMzoFnzkCbq5QmLuYHiGOAoKeBRwy1g7QWO47areEurQR_0jZH4qYd368xI5WlnYWyObl0kQTGoIKnES4caBH3S9Vqus6cLqwNa7GWW3Tj45B0dG_T6_XINH7F8juEMoy2zbS0jyU50IC/s1600/apartment2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEilMzoFnzkCbq5QmLuYHiGOAoKeBRwy1g7QWO47areEurQR_0jZH4qYd368xI5WlnYWyObl0kQTGoIKnES4caBH3S9Vqus6cLqwNa7GWW3Tj45B0dG_T6_XINH7F8juEMoy2zbS0jyU50IC/s1600/apartment2.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgP3h0rr5KBkG1yBxxoRZOP22SKu6GsgkEpPjppdXVFnjI1GCiIJOSoufxHotU2BjK56hgTWfFDB7vyHg9C8S-M78uk1BVA-d-Nog7gg7d5szanw1E-iAnLw0OlUQ6AadxP83WzOuTvBqx-/s1600/apartment3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgP3h0rr5KBkG1yBxxoRZOP22SKu6GsgkEpPjppdXVFnjI1GCiIJOSoufxHotU2BjK56hgTWfFDB7vyHg9C8S-M78uk1BVA-d-Nog7gg7d5szanw1E-iAnLw0OlUQ6AadxP83WzOuTvBqx-/s1600/apartment3.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEju0sUGbXioABC9CqOMj8X4bNazFKWX8OuM6BqPUzo00Ca5S2PoCVQgSUas_pdYmnoVrWecvqq-0Ne5CWCOURsafXBWES4BMZWXIlXVmYsQ6y0BFimyObCqQC71Mpr7NEPL5h6npEcGojNY/s1600/apartment4.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEju0sUGbXioABC9CqOMj8X4bNazFKWX8OuM6BqPUzo00Ca5S2PoCVQgSUas_pdYmnoVrWecvqq-0Ne5CWCOURsafXBWES4BMZWXIlXVmYsQ6y0BFimyObCqQC71Mpr7NEPL5h6npEcGojNY/s1600/apartment4.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjlN5BVuvdPqSzICaRvEzlUsHlVivAbFX8cjbgNB4RWsl1M2x7bnEltSY_Vj1hj_Z1Feca2hNZ154zBnKcqJlAXLyZGMSDIVM-qOp0Je4tnXOFI8ENS6ufdJb6ZVSrQ8bk853joQi-NUN6V/s1600/apartment5.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjlN5BVuvdPqSzICaRvEzlUsHlVivAbFX8cjbgNB4RWsl1M2x7bnEltSY_Vj1hj_Z1Feca2hNZ154zBnKcqJlAXLyZGMSDIVM-qOp0Je4tnXOFI8ENS6ufdJb6ZVSrQ8bk853joQi-NUN6V/s1600/apartment5.jpg" /></a></div> <br /> <h2 style="text-align: center;"> Here's a little peak into our apartment!</h2> <div> I've been meaning to share some pictures for a while, but I just never feel like this place is finished/pretty enough, so I always put it off. We're doing a few more projects in it soon, so I'll make sure to share more pictures soon.</div> <div> <br /></div> <div> I hope you liked seeing these pics - personally, I just adore home decor posts, they're some of the most fun to read. :) I can't wait to show you the finished product as well.</div> <div> <br /></div> <div style="text-align: center;"> <b><i>What's your favorite homeware store?</i></b></div> http://nothinfancyreally.blogspot.com/2016/11/mini-apartment-tour.htmlnoreply@blogger.com (Živa)11tag:blogger.com,1999:blog-2743690106034386179.post-5136867688557007271Wed, 23 Nov 2016 17:29:00 +00002016-11-23T18:29:22.059+01:00beautycaudaliedrugstorefeeluniquegarnierhaircarehigh endlipstickliquid lipstickmakeupmuradnyxouaishoppingskincareurban decayzoellaFeelUnique Fall Beauty Haul 2016<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQJUTIZF-dsEgyXr4mw7XiRfvIsvmbaHTTWsmAaclk26SMFO5YaW_JF5tQlAlJ0EncteOysssmLazaAtpNeli_kWdTHm4GCslvW49BNEFbJpvjYi5U91uzdVuM4lvv_uUC8slE8Mj7PjiR/s1600/feelunique_beauty_fall_haul_2016_1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQJUTIZF-dsEgyXr4mw7XiRfvIsvmbaHTTWsmAaclk26SMFO5YaW_JF5tQlAlJ0EncteOysssmLazaAtpNeli_kWdTHm4GCslvW49BNEFbJpvjYi5U91uzdVuM4lvv_uUC8slE8Mj7PjiR/s1600/feelunique_beauty_fall_haul_2016_1.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgoyoaciDJSyniG8794V5CjR9fRNgHgLLPTtQA6Jpw9FDaFCdYuQTLlQBAFwRBLN7BvfHp-8TneGS7ibubXwnecXhVOYIhIsRYMEgAK8B8o3zVOFueeyt8fVBzwabqaDLFftTyZXTMUKCRj/s1600/feelunique_beauty_fall_haul_2016_2.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgoyoaciDJSyniG8794V5CjR9fRNgHgLLPTtQA6Jpw9FDaFCdYuQTLlQBAFwRBLN7BvfHp-8TneGS7ibubXwnecXhVOYIhIsRYMEgAK8B8o3zVOFueeyt8fVBzwabqaDLFftTyZXTMUKCRj/s1600/feelunique_beauty_fall_haul_2016_2.JPG" /></a></div> <h4 style="text-align: center;"> Time for a quick FeelUnique haul!</h4> <div style="text-align: left;"> I haven't shopped on their website in ages and there were a few things I wanted to try out, along with a few Christmas gifts I needed to shop for, so here we go... I got a couple of products I've been lusting after for ages!</div> <h3 style="text-align: center;"> Murad Clarifying Cleanser</h3> <div> I've heard several Youtube gurus talking about this, namely MissTiffanyD who recommended it time and time again. While I don't suffer from acne anymore, my skin is still <b>blemish prone,</b> and I hope this will help keep impurities at bay, especially during that time of the month. You can purchase it <a href="https://eu.feelunique.com/p/Murad_clarifying_cleanser_200ml">here </a>for 25€. I've tried it out already and it has a strong <b>minty scent</b>, feels very refreshing.</div> <h3 style="text-align: center;"> Caudalie Vinoperfect Overnight Renewal Cream&nbsp;</h3> Lately I've been using the Caudalie Vinosource SOS Serum, which is arguably my favorite skincare item of all time, so I just had to try a few more things from them. Haven't tried this<b> night cream</b> out yet, but I'll apply it tonight before bed and keep you posted. Available <a href="http://eu.feelunique.com/p/Caudalie-Vinoperfect-Overnight-Renewal-Cream-40ml">here </a>for 41€.<br /> <h3 style="text-align: center;"> OUAI Texturizing Hair Spray</h3> I ran out of my Charles Worthington <b>Texturizing Spray</b> and man, do I miss it... I had to get an alternative and I've heard great things about OUAI so I thought I'd give it a try. The only annoying thing about ordering aerosols is, you have to pay for premier shipping since there are some regulations in the EU about them (goodbye, sweet sweet 20€). Available <a href="http://eu.feelunique.com/p/OUAI-Texturizing-Hair-Spray-130g">here </a>for 28€.<br /> <h3 style="text-align: center;"> Zoella Beauty Secret Scenta Fragrance Set</h3> Yes, I am a child for ordering this, but I don't care! Body mists last like 3 minutes on me so I got these for my bed linen, I just <b>love spraying my bed with a yummy scent before bed</b>. I'm a little disappointed in the gingerbread scent, it seems a little synthetic, but Sweet Inspirations is lovely. I have yet to try the others. Available <a href="http://eu.feelunique.com/p/Zoella-Beauty-Secret-Santa-Fragrance-Set">here </a>for 20€, and it would be such a cute gift for a friend for Christmas!<br /> <h3 style="text-align: center;"> Urban Decay All Nighter Makeup Setting Spray&nbsp;</h3> I got 10% off UD as a FeelUnique member (you can pick your favorite brand and always get 10% off it). I've wanted this spray for friggin' ages, and I can't wait to let you know if it works as well as everyone says. <b>Travel size </b>for now, because I want DeSlick next. Available <a href="http://eu.feelunique.com/p/Urban-Decay-All-Nighter-Makeup-Setting-Spray-Travel-Size-30ml">here</a>, 13€.<br /> <h3 style="text-align: center;"> NYX Lingerie Liquid Lipstick</h3> I got a few shades - <b>Teddy, Beauty Mark, Embellishment and Honeymoon</b>. I'm all about those brownish nudes at the moment and I'm really excited to try these. At 8€ a pop, they're one of the cheapest liquid lippies at the moment and I can't wait to wear them. Buy <a href="http://eu.feelunique.com/p/NYX-Lingerie-Liquid-Lipstick-4ml">here</a>.<br /> <h3 style="text-align: center;"> Garnier Micellar Water</h3> Oldie goldie, I always come back to this one in the end. My other favorites are Corine De Farme and Vichy, but I absolutely despise Bioderma, it makes my eyes sting and itch and dries them out. This was on offer for like 3€, now it's around 5 <a href="http://eu.feelunique.com/p/Garnier-Cleansing-Micellar-Water-400ml">here</a>.<br /> <br /> I got a few presents as well that I don't want to show, because someone might be reading this post! :P Can't wait to do some reviews on these goodies.<br /> <div style="text-align: center;"> <b><i>What was your last beauty buy?</i></b></div> http://nothinfancyreally.blogspot.com/2016/11/feelunique-fall-beauty-haul-2016.htmlnoreply@blogger.com (Živa)0tag:blogger.com,1999:blog-2743690106034386179.post-7381396853000130651Sun, 13 Nov 2016 19:33:00 +00002016-11-13T20:33:29.117+01:00candleshome decorlifestyleyankee candleFall 2016 Yankee Candle Haul<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEie0sT2chPTTJBTqYvQ4IdNHquqfLZU3TtFsY5ZVmXBMsURH8L2kTV6GbtOSnw4sB8IaUJ_vKQBItTGcNE8jD_X7OZ_Vp22YNZkrf0HT-35zCQUcvEnAjXGh5ZbAH_qg0sZlbSAfqVg9xjr/s1600/yankee_candle_fall_2016_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEie0sT2chPTTJBTqYvQ4IdNHquqfLZU3TtFsY5ZVmXBMsURH8L2kTV6GbtOSnw4sB8IaUJ_vKQBItTGcNE8jD_X7OZ_Vp22YNZkrf0HT-35zCQUcvEnAjXGh5ZbAH_qg0sZlbSAfqVg9xjr/s1600/yankee_candle_fall_2016_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi-_Gsx-vfXjgFGCaCiTKcGzj5KyVeXdinnc30zQQAjHbs60HR3n5ZLtfDyy1uqfoESVq3f4mQUII2szK5eX7vdAjOHHI8Dfqe00C_OIouB5nA5mTUmvn5N-DMSIQKa32ME8JNUgmIMja4D/s1600/yankee_candle_fall_2016_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi-_Gsx-vfXjgFGCaCiTKcGzj5KyVeXdinnc30zQQAjHbs60HR3n5ZLtfDyy1uqfoESVq3f4mQUII2szK5eX7vdAjOHHI8Dfqe00C_OIouB5nA5mTUmvn5N-DMSIQKa32ME8JNUgmIMja4D/s1600/yankee_candle_fall_2016_haul_2.jpg" /></a></div> <br /> <h4 style="text-align: center;"> <span style="font-size: large;">You know you haven't been posting on your blog enough when you have 2 candle hauls to do...</span></h4> <div> <span style="font-size: large;"><br /></span></div> <div> And here is the first one! I always love doing my Yankee hauls. Living with three pets can be messy (and stinky) which is why I always like to have a candle burning. I paid my monthly visit to the Yankee Candle store and picked out a few new scents.</div> <h3 style="text-align: center;"> YC Cranberry Pear</h3> <div> Well, hate to be a downer, but I don't like this scent at all - my boyfriend actually picked it out. I'm not a fan of <b>artificial fruit </b>scents, they smell a little <b>plastic</b>-y to me, but he loves it, so whatever. :P This doesn't smell like pear to me (a real shame because I ADORE pear and pear blossom notes), it does smell like cranberry though. Slovenian link <a href="http://yankeecandle.si/catalogsearch/result/?q=cranberry+pear">here</a>, international <a href="http://www.yankeecandle.co.uk/search?Ntt=cranberry+pear&amp;Ns=DefaultSort%7C0%7C%7Csku.displayName%7C0&amp;No=0&amp;Nrpp=10">here</a>.</div> <h3 style="text-align: center;"> YC Tarte Tatin</h3> <div> OMG, I think this is limited edition, and what a shame that is, because I freaking love it. Smells like <b>cinnamon with apple and pie crust</b>. Honestly, I just want to eat it! It makes me feel so cozy and happy, and I would really recommend this one for that autumn feel. Purchase <a href="http://yankeecandle.si/catalogsearch/result/?q=tarte+tatin">here </a>for Slovenia, <a href="http://www.yankeecandle.co.uk/search?Ntt=Tarte+Tatin&amp;Ntk=sku.fragranceName&amp;Ntx=mode+matchallpartial&amp;Ns=DefaultSort|0||sku.displayName|0">here </a>for international.</div> <h3 style="text-align: center;"> YC Honey Clementine</h3> <div> This one is long gone because I just had to use it up as soon as I got it. <b>Delicious, syrupy honey with fresh and zesty clementine</b> - a dream come true! I adored it. Oh, I think this is limited edition too - but at least the good news is the autumn line was a win for me. Buy it <a href="http://yankeecandle.si/catalogsearch/result/?q=Honey+Clementine">here </a>or <a href="http://www.yankeecandle.co.uk/search?Ntt=Honey+Clementine&amp;Ntk=product.categoryname&amp;Ntx=mode+matchallpartial&amp;Ns=DefaultSort|0||sku.displayName|0">here</a>, if not in Slovenia.</div> <div> <br /></div> <h3 style="text-align: center;"> YC Rhubarb Crumble</h3> <div> I think my boyfriend stole and burned this one, tsk tsk. <b>Smells fresh, zesty and has a baking note as well.</b> Very pleasant but not my favorite out of the autumn line, I preferred Tarte Tatin and Honey Clementine. Still a good scent to buy. Link <a href="http://yankeecandle.si/catalogsearch/result/?q=Rhubarb+Crumble">here</a>, international <a href="http://www.yankeecandle.co.uk/search?Ntt=Rhubarb+Crumble&amp;Ns=DefaultSort%7C0%7C%7Csku.displayName%7C0&amp;No=0&amp;Nrpp=10">here</a>.</div> <div> <br /></div> <div style="text-align: center;"> I just adore fall collections from Yankee Candle, and now I'm even more excited about the Christmas line! Can't wait to shop it next.&nbsp;</div> <div style="text-align: center;"> <b><i>What's your favorite candle scent?</i></b></div> http://nothinfancyreally.blogspot.com/2016/11/fall-2016-yankee-candle-haul.htmlnoreply@blogger.com (Živa)4tag:blogger.com,1999:blog-2743690106034386179.post-8255128872853346529Thu, 08 Sep 2016 11:48:00 +00002016-09-08T13:55:45.659+02:00acnefoundationla roche posayskincareEffaclar Duo(+) Unifiant Review & Rave<div class="separator" style="clear: both; text-align: center;"> </div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh4Tm_wkqIqHpJwwA5ONcpTcEQQQq-ZkepTeB1wBBwF8hZmn9kgCVvx_Zfmhbr-tYX0sO7gFX7AeQ8-tgxYXSYsR8mmE2zI-Q02IB21rbsm14BilDIcOPOXhKZ6rucBuhJdOmY_Po4zWi0g/s1600/effaclar_unifiant_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh4Tm_wkqIqHpJwwA5ONcpTcEQQQq-ZkepTeB1wBBwF8hZmn9kgCVvx_Zfmhbr-tYX0sO7gFX7AeQ8-tgxYXSYsR8mmE2zI-Q02IB21rbsm14BilDIcOPOXhKZ6rucBuhJdOmY_Po4zWi0g/s1600/effaclar_unifiant_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhWgkkObeGxd3gAWE9bVXVjPvO_qYsQ8TkNdsXRWynt8XFJLntBoqlU2W7D2T_tQRtC0Zr7OzSb0Efq4lmVRk_oKGKJKoQ1U-Sm6_Ld2TzH7TosUo6AXWjvNqu1yVgI5wQTaKuxByRxRgXQ/s1600/effaclar_unifiant_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhWgkkObeGxd3gAWE9bVXVjPvO_qYsQ8TkNdsXRWynt8XFJLntBoqlU2W7D2T_tQRtC0Zr7OzSb0Efq4lmVRk_oKGKJKoQ1U-Sm6_Ld2TzH7TosUo6AXWjvNqu1yVgI5wQTaKuxByRxRgXQ/s1600/effaclar_unifiant_2.jpg" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <h3 style="text-align: center;"> <span style="text-align: center;">Have you ever wanted a skincare product that gave you an amazing coverage as well?</span></h3> <div class="separator" style="clear: both; text-align: left;"> If you've been reading my blog for a while, I'm sure you know I'm a huge fan of La Roche Posay. When I was younger and had acne, their Effaclar Duo treatment helped me a lot, and since then I've tried most of the range, including the gel, toner and A.I. products.&nbsp;</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> A few years ago, LRP came out with Effaclar Duo(+), which was my first disappointment in the range. After loving the original Duo, Duo(+) broke me out horribly, and it took me months to get rid of the red marks - and it was the first time I broke out because of a product as my skin isn't sensitive to them usually.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> So you can understand my hesitation when I was offered to try out the new <b>Duo(+)</b> product. This is a skincare treatment, but it is <b>tinted </b>and supposed to give you some <b>coverage </b>as well as treating your skin. In the end, I decided I had more wins than losses with LRP, and I gave it a go.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I wouldn't be writing this post if I didn't end up loving the product. I am really impressed with this - it has all the properties I loved with the original Duo and so many more new ones that I've fallen in love with. Instead of rambling on about it, I'm just going to post a pros/cons list below.</div> <h4 style="clear: both; text-align: left;"> Cons:</h4> <div class="separator" style="clear: both; text-align: left;"> </div> <ul> <li>The shade is a little <b>too dark </b>for me (Light), so I wish this came in a shade lighter.</li> </ul> <br /> <h4 style="clear: both; text-align: left;"> Pros:</h4> <div class="separator" style="clear: both; text-align: left;"> </div> <ul> <li>Gives a beautiful finish, not dewy, but not matte either (<b>semi-matte</b>)</li> <li>No shine peeks through, it's not heavy, but very <b>light </b>and feels like nothing on the skin.</li> <li>Smells wonderful and it is a pleasure to apply.</li> <li>Unbelievable <b>coverage</b>. I have huge pores and a lot of red marks, and this covered all of them.</li> <li>Affordable at around <b>14€</b>.</li> <li>Helps my skin while giving it the coverage it needs on a daily basis.</li> <li>Doesn't clump or look cakey,<b> doesn't sit in pores</b>, has never balled up on my skin.</li> <li>Coverage-wise, closer to foundation than a BB cream, but light nonetheless.</li> <li>Doesn't irritate, feels pleasant and lovely on the skin.</li> <li>Comes with <b>40 ml </b>of product.</li> </ul> <br /> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> Needless to say, I've fallen in love with this product and I've already gone through half a bottle. I work from home, and on days when I'm just in the flat or running errands, I couldn't wish for a better product. Love this.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i>What is your favorite skincare product that gives coverage?</i></b></div> <div class="separator" style="clear: both; text-align: center;"> Keep reading for the Slovenian version of this post + a giveaway!</div> <div class="separator" style="clear: both; text-align: center;"> </div> <a name='more'></a><br /> <br /> <h3 style="text-align: center;"> Si si kdaj želela izdelek za nego kože, ki bi ti nudil tudi popolno prekrivnost?</h3> <div> Če moj blog spremljaš že dlje časa, se gotovo spomniš mojega navdušenja nad izdelki La Roche Posay. Preizkusila sem celotno linijo za problematično kožo, se navduševala nad originalnim Effaclar Duo in bila bitko z Duo(+).</div> <div> <br /></div> <div> Preden sem sprejela vabilo, da preizkusim Duo(+) Unifiant, sem oklevala kar nekaj časa, saj me je zadnji izdelek iz te linije razočaral. Po Duo(+) sem dobila hud 'breakout', rdečih madežev sem se znebila šele po nekaj mesecih, pa sploh nimam občutljive kože.</div> <div> <br /></div> <div> K sreči se zgodba pri novosti LRP ni ponovila - Unifiant me je popolnoma navdušil in ima sedaj častno mesto v moji rutini. Namesto da brbljam o tem, kako me je navdušil, sem pripravila kar seznam prednosti in slabosti. Ker ima slabost (po mojem mnenju) le eno, začnimo s to...</div> <h4> Slabosti</h4> <div> <ul> <li>Le<b> 2 odtenka</b>. Meni je Light nekoliko pretemen, vendar izgleda OK, če ga zmešam z Effaclar AI ali The Body Shop kapljicami za posvetlitev pudra.</li> </ul> <h4> Prednosti</h4> </div> <div> <ul> <li>Daje čudovit <b>semi-matte finiš</b>.</li> <li>Skozi podlago masten videz ne prodira, obenem pa je lahek in prijeten na koži.</li> <li>Čudovito diši in je prijeten za nanos.</li> <li>Neverjetna <b>prekrivnost </b>- je bolj podobna pudru kut BB kremi.</li> <li>Stane okrog <b>14€</b>, tako da je cena ugodna.</li> <li>Moji koži pomaga, obenem pa zakriva nepravilnosti.</li> <li>Ne useda se v pore, ne izgleda 'cakey', nikoli se ne 'svaljka' po koži - problem, ki sem ga imela pri tako originalnem Duo kot Duo(+).</li> <li><b>Ne draži kože</b> (niti malo), daje prijeten občutek, kot da nimaš na sebi ničesar.</li> <li>V embalaži je <b>40 ml </b>izdelka.</li> </ul> <div> Verjetno mi ni treba še enkrat poudariti, da me je izdelek navdušil. Porabila sem že pol tubice. Ker delam od doma, je Unifiant popoln, tudi za takrat, ko moram na hitro v trgovino. Toplo priporočam.</div> </div> <h3 style="text-align: center;"> <a href="https://www.facebook.com/nothinfancyreally/">Na mojem Facebook profilu te čaka tudi nagradna igra, v kateri lahko zadaneš čisto svoj Duo(+) Unifiant.</a></h3> <div> <br /></div> http://nothinfancyreally.blogspot.com/2016/09/effaclar-duo-unifiant-review-rave.htmlnoreply@blogger.com (Živa)4tag:blogger.com,1999:blog-2743690106034386179.post-5494445490853744832Wed, 10 Aug 2016 12:21:00 +00002016-08-10T14:21:41.913+02:00catricedrugstoreeosessencehaulmakeupmaybellineshoppingSummer 2016 Drugstore Makeup Haul<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQrwF_HZy5AlCdZm3DpWWkDNhWVy80OSz7LD-2VeocsS5LYLDiopjE3Y67B9lolwAQokFUNbNHQOsNFewnbzoWSWSyyZdvYe_Ai-PuHcJukfzvhLYVqHItWwrGi-d_CJzTzoXn7nQYz7mT/s1600/summer_drugstore_makeup_haul_2016_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQrwF_HZy5AlCdZm3DpWWkDNhWVy80OSz7LD-2VeocsS5LYLDiopjE3Y67B9lolwAQokFUNbNHQOsNFewnbzoWSWSyyZdvYe_Ai-PuHcJukfzvhLYVqHItWwrGi-d_CJzTzoXn7nQYz7mT/s1600/summer_drugstore_makeup_haul_2016_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgSeUi1FdPOPkhTac7ihWzQpWeIXmh8sElGQ6-kK8RJLz-k-hOYxyjHtHOtIXH034rbbgEg_iwA4kUxPGyUz1V0WAxx7-5OJXI1RWn0NTQAzo_3BKb8pj55mNttooSqxEZT_s9cCF5ZN9oq/s1600/summer_drugstore_makeup_haul_2016_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgSeUi1FdPOPkhTac7ihWzQpWeIXmh8sElGQ6-kK8RJLz-k-hOYxyjHtHOtIXH034rbbgEg_iwA4kUxPGyUz1V0WAxx7-5OJXI1RWn0NTQAzo_3BKb8pj55mNttooSqxEZT_s9cCF5ZN9oq/s1600/summer_drugstore_makeup_haul_2016_2.jpg" /></a></div> <h2 style="clear: both; text-align: center;"> Hello ladies!</h2> <div> I went on a little shopping spree in my nearby Drogerie Markt, and I wanted to share my buys with you today. I've been meaning to pick up some new lipsticks, and I also needed a new powder, but of course I ended up with waaay too much stuff yet again. Let's see what we have...</div> <h3 style="text-align: center;"> EOS Lip Balm Strawberry Sorbet</h3> <div style="text-align: left;"> I know the hype for these has kind of died down, but I just discovered them recently and I am in. Freaking. Love. My favorite is the <b>sweet mint</b> scent, but I wanted another one for my collection. It's super fruity and sweet, and it moisturizes well without being oily (it's more <b>waxy</b>). These are expensive for lipbalm, about 7€ a pop, but compared to stuff like the by Terry Baume De Rose, I'm fine with paying that. Of course, my puppy already chewed it up... Oh well.&nbsp;</div> <h3 style="text-align: center;"> Maybelline Vivid Matte Liquid Lipsticks</h3> <div style="text-align: left;"> I saw a few reviews for these, and I already have a red shade, so I wanted to pick up a few more. So far I've only worn <b>05 Nude Flush</b> (I also got a vampier shade, <b>45 Possessed Plum</b>), and it felt my lips weirdly <b>tingly</b>... This didn't happen with the red shade, so I'm wondering what the problem was - almost felt like a slight allergic reaction! I love the shade though. These are about 9€ and you can purchase them <a href="http://eu.feelunique.com/p/Maybelline-New-York-Color-Sensational-Vivid-Matte-Liquid-Lipstick-8ml">here</a>.</div> <h3 style="text-align: center;"> Catrice All Matt Powder</h3> <div style="text-align: left;"> I adore Catrice powders. I've tried most of them, but not this one, so I had to get it for about 4€. I've tried it already and it's absolutely lovely. <b>Very smooth, finely milled</b> and absolutely lovely. Will repurchase for sure. I think powders are definitely something you can get from the drugstore without giving up the quality.</div> <h3 style="text-align: center;"> Catrice Blush Artist Shading Palette</h3> <div style="text-align: left;"> Got this in the shade 020 CorAll I Need. Pretty, but nothing special. They're not really blushes as they're quite sheeny and <b>don't have a lot of color payoff</b>. I would sooner use them as blush overlays. About 5€ for this palette. The shades are very pretty, though.</div> <h3 style="text-align: center;"> Catrice Deluxe Glow Highlighter</h3> <div> I haven't tried everything from this palette yet, but it seems great. The left <b>highlighter </b>is lovely, and the <b>bronzier </b>shade is good for contouring for Snow Whites like me (seriously, where is my tan, it's summer). Same price as the blush palette, I would recommend this one over the previous product.</div> <h3 style="text-align: center;"> Catrice Pret-a-Volume Smokey Mascara Velvet Black</h3> <div> I mean, this is an okay mascara, just a little <b>disappointing</b> to me. The result seems quite <b>natural</b>, and I was expecting something extremely dramatic. Seeing the brush, I was sure it would smudge and crumble, but thankfully it doesn't do that. Not my favorite. About 6€.</div> <h3 style="text-align: center;"> Catrice Fluid Lipstick Intense</h3> <div> Got this in the shade 040 Rose Your Voice! Haven't tried it yet, but the swatch was lovely. I'm super into these rosey, nude shades lately. I'll keep you posted on this one. I think it was about 4€.</div> <h3 style="text-align: center;"> Catrice Matt Lip Artist</h3> <div> These crayons are just lovely. I got two shades, <b>030 Barberry Hopping</b> and &nbsp;<b>010 Bare Nude's Soul</b>. One is more nude, &nbsp;the other more red. I was initially afraid these would end up on my teeth as they're very creamy, but they seem fine. Love the <b>matte dry down</b> and the price - 5€. I think these are limited edition, which is really a shame.</div> <h3 style="text-align: center;"> Catrice High Glow Mineral Highlighting Powder</h3> <div style="text-align: left;"> I couldn't resist, it's so pretty! But unfortunately, this highlighter is <b>way too shimmery</b> for me. It's finely milled, but just not a great product. I wish the color was darker as well, as it's too light even for me, and that's saying something. It costs about 4€.</div> <h3 style="text-align: center;"> Catrice Camouflage Concealer</h3> <div style="text-align: left;"> Been hearing great stuff about this. I want to do a comparison to Urban Decay Naked. Pretty sure I had it before and loved it! It costs around 5€. It is very <b>velvety and smooth</b>.</div> <h3 style="text-align: center;"> Essence The Beach House Blusher</h3> <div style="text-align: left;"> Isn't this adorable?! I want to get back into Essence blushers, I used to purchase them with every limited collection and they're absolutely lovely (anyone remember their Marble collection from years ago? That was probably my favorite blusher of all time). This was on sale for about 2€, since it's an older collection.</div> <h3 style="text-align: center;"> Catrice Ultimate Stay Lipsticks</h3> <div style="text-align: left;"> I absolutely adore these, and they're a bargain at around 5€. I got two shades, <b>070 Plum &amp; Base</b> and <b>060 Floral Coral</b>. Beautiful shades, pleasant application and they feel great on the lips. I want every shade!</div> <div style="text-align: left;"> <br /></div> <div style="text-align: left;"> Hope you enjoyed this haul! I'm really excited about another brand arriving in Slovenia - L.O.V., and I might be picking up some bits from them as well. Until next time!</div> <div style="text-align: center;"> <b><i>What's your favorite drugstore makeup item?</i></b></div> http://nothinfancyreally.blogspot.com/2016/08/summer-2016-drugstore-makeup-haul.htmlnoreply@blogger.com (Živa)5tag:blogger.com,1999:blog-2743690106034386179.post-6121546206211742856Mon, 18 Jul 2016 13:42:00 +00002016-07-18T15:42:03.862+02:00haulhmhomehome decorinterior designonline shoppingshoppingH&M Home Haul<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjFESEeQ-pJrWPGzk972V90eONdpVTuoi0T-rEbBeR7Z78824HPVVYFPK-pPuxCraRi3cUFdXbQgP8LGt9bZAxzXGz4RIPazqDhBkUTrzimKE1lJrkprWm4UgD_sPWv1-L0Rthu3eBk5o30/s1600/hm_home_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjFESEeQ-pJrWPGzk972V90eONdpVTuoi0T-rEbBeR7Z78824HPVVYFPK-pPuxCraRi3cUFdXbQgP8LGt9bZAxzXGz4RIPazqDhBkUTrzimKE1lJrkprWm4UgD_sPWv1-L0Rthu3eBk5o30/s1600/hm_home_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEianf7hAZMCY8J8ThjHCr43RcZgKTtKp0_EagbRmx-EDrg61BCEmWPrkCXeb4JSBLwJ-tHO0VdbiE8JStv2tKkOhA8ADEIFjhaHc2G0qIC40lTlIwnSBa4E3CQ8r7qaSQqYJyfK-m1CWd3M/s1600/hm_home_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEianf7hAZMCY8J8ThjHCr43RcZgKTtKp0_EagbRmx-EDrg61BCEmWPrkCXeb4JSBLwJ-tHO0VdbiE8JStv2tKkOhA8ADEIFjhaHc2G0qIC40lTlIwnSBa4E3CQ8r7qaSQqYJyfK-m1CWd3M/s1600/hm_home_haul_2.jpg" /></a></div> <h3 style="text-align: center;"> I've been shopping like crazy...</h3> <div> And I feel like I'm getting old, because nothing feels as good as shopping for things for my home at the moment! :) I placed an order on H&amp;M Home and today I wanted to share a few cute things I picked up from them. I'm so excited they started delivering their home things to Slovenia!</div> <div> <br /></div> <div> Let's start of with this <a href="http://www2.hm.com/en_eur/productpage.0278852011.html"><b>grey blanket</b></a>, which comes in a few other colors (here's hoping I can eventually convince my boyfriend to get the pink one as well). It costs 30€ and it's incredibly <b>soft</b>, perfect for snuggling up! I'm kind of getting tired of those super soft polyester blankets because they get ruined fast and don't look very expensive, so this is a great alternative.</div> <div> <br /></div> <div> I also got a whole bunch of <b>candles</b>: <a href="http://www2.hm.com/en_eur/productpage.0340895026.html">Honey Blossom</a> - a sweeter scent, <a href="http://www2.hm.com/en_eur/productpage.0340895013.html">Green Tea</a> - sharp and citrusy, and <a href="http://www2.hm.com/en_eur/productpage.0340895015.html">Cotton Flower</a> - gentle and soft. I'm so glad I was able to get a few candles from H&amp;M, I love them and they're a good <b>bargain </b>at only 8€.</div> <div> <br /></div> <div> My favorite buy is probably this beautiful <b><a href="http://www2.hm.com/en_eur/productpage.0399148001.html">round vase</a></b>, which is glass and has a<b> gold rim</b> on top. I think it would look stunning with peonies, which I really need to buy if they're even still in season! The vase costs 20€, and there is also a smaller version available.</div> <div> <br /></div> <div> I got a cute <b><a href="http://www2.hm.com/en_eur/productpage.0352684002.html">napkin holder</a></b> which goes nicely with the coasters I showed you in my Zara haul. It cost 8€ which is a bit stupid since it's just a bit of metal... And it also comes in rose gold.</div> <div> <br /></div> <div> Finally, because I am a child, I got a <b><a href="http://www2.hm.com/en_eur/productpage.0310194001.html">plate </a></b>and <b><a href="http://www2.hm.com/en_eur/productpage.0309988001.html">mug </a></b>with a <b>cat motif</b>. Of course I had to buy them, do you even know me? :P I think they're adorable, and I'm pretty sure they're meant for children, but I'll probably use them for photos and decor. They are both 6€ and there is also a <a href="http://www2.hm.com/en_eur/productpage.0310153001.html">bowl </a>available.</div> <div> <br /></div> <div> I'll definitely order from H&amp;M home again. I keep wishing these companies did furniture as well because I'm sure it would be adorable. But until they get on that bandwagon, I'm happy with their cute decor stuff!</div> <div style="text-align: center;"> <b><i>What's the last thing you bought for your apartment?</i></b></div> <div style="text-align: center;"> <br /></div> http://nothinfancyreally.blogspot.com/2016/07/h-home-haul.htmlnoreply@blogger.com (Živa)14tag:blogger.com,1999:blog-2743690106034386179.post-4612932985014055674Wed, 13 Jul 2016 10:25:00 +00002016-07-13T12:25:49.093+02:00bodycareelie saabhaulperfumeshoppingskincarethe body shopMini Summer Airport Haul<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj8Ho8PuXZ9a_bBc0LF8Nef0wESyMmKY5IQCoViOPJEFkpKj-vYYLP3eU211_JIRHaYlciiS7VtQaT8OE3u-METvlZoDBeeL47_CUzQERI4M6KqM2kUSisnUTVU1RsOEdcK4oYo-B-WKeep/s1600/summer_airport_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj8Ho8PuXZ9a_bBc0LF8Nef0wESyMmKY5IQCoViOPJEFkpKj-vYYLP3eU211_JIRHaYlciiS7VtQaT8OE3u-METvlZoDBeeL47_CUzQERI4M6KqM2kUSisnUTVU1RsOEdcK4oYo-B-WKeep/s1600/summer_airport_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlalaYGY71Ox8_Gn1yi9_3v4SA_w0dHcn_C4NB7VY_Dxc5OeG0lGJ0PJEbUK3VPjCBVNZp1GUU4UwomwbH3-DleMRy3Lp6H75zGJdRyEKdx9r-h65hGjzfQ_heSMGLUbMdvXzzaXCQ5CAN/s1600/summer_airport_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlalaYGY71Ox8_Gn1yi9_3v4SA_w0dHcn_C4NB7VY_Dxc5OeG0lGJ0PJEbUK3VPjCBVNZp1GUU4UwomwbH3-DleMRy3Lp6H75zGJdRyEKdx9r-h65hGjzfQ_heSMGLUbMdvXzzaXCQ5CAN/s1600/summer_airport_haul_2.jpg" /></a></div> <h2 style="clear: both; text-align: center;"> What's a girl to do when she gets to the airport 3 hours too early?</h2> <div> Well, shop - of course! I only ended up getting a few bits but I still wanted to show you my haul from the Nice airport. They have a tiny Duty Free and I wasn't that into the stuff there, but I still managed to pick up 4 new products.</div> <h3 style="text-align: center;"> Perfume</h3> <div> Starting with perfume, I got a long-coveted scent - <b>Elie Saab Le Parfum L'Eau Couture EDT</b>.&nbsp;This scent is absolutely divine and so, so special. It doesn't have a lot of notes, mainly vanilla, orange blossom and green almond. I smell all of those and they make for the loveliest soft scent. It's inoffensive and perfect for hot summer days when you don't want to wear something as cloying as Bronze Goddess, for example. I love it! Available <a href="http://www.allbeauty.com/1060294-elie-saab-leau-couture-eau-de-toilette-spray-90ml">here&nbsp;</a>&nbsp;from 62€.</div> <h3 style="text-align: center;"> Body</h3> <div> Next up, I found a well-stocked <b>TBS </b>section and I just had to pick up a few things. I was very curious about the English Rose range, but they didn't have testers and I decided to be a sensible human being and not blind buy. I did however, find some bits from the <b>Honeymania </b>range, and ended up getting the<b> Body Butter</b> and<b> Shower Gel </b>from the line. So excited about these - honey is my favorite note of all time. Body butters are around 15€, and the shower gel was 6,40€.</div> <div> <br /></div> <div> I also grabbed a <b>Strawberry Body Polish</b> from <b>The Body Shop</b>, which is a product I've had before and really loved. I don't remember the scent being quite so sickly sweet, but I'll still use it up. I know my boyfriend will love it, even if I don't. The body polish cost around 8€.</div> <div> <br /></div> <div> That's it, my teeny tiny France haul! I wanted to wander into Sephora, but the only time I was there, I was completely exhausted and couldn't handle it (shock! horror!) Next time for sure, though... I have a few more trips in my future. ;)</div> <div style="text-align: center;"> <b><i>What was your last summer beauty buy?</i></b></div> <div style="text-align: center;"> <br /></div> http://nothinfancyreally.blogspot.com/2016/07/mini-summer-airport-haul.htmlnoreply@blogger.com (Živa)10tag:blogger.com,1999:blog-2743690106034386179.post-3583062999720273860Tue, 12 Jul 2016 11:00:00 +00002016-07-12T13:00:37.740+02:00homehome decorinterior designzaraZARA Home Haul<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgPSokUkcTRk3WMmltLQhnyet6rLlAX2CnJZbu6tUtg36EYei0kGnf44ygdnvF-ETfYcMbf1gHpZhlVlK6y7OkyIuftGe0fopi6uIpi8hx6GqyK3QtGxsUPWtz8k2VPsPsDNEDLwmKZtWZG/s1600/zara_home_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgPSokUkcTRk3WMmltLQhnyet6rLlAX2CnJZbu6tUtg36EYei0kGnf44ygdnvF-ETfYcMbf1gHpZhlVlK6y7OkyIuftGe0fopi6uIpi8hx6GqyK3QtGxsUPWtz8k2VPsPsDNEDLwmKZtWZG/s1600/zara_home_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgdgjc1AKaeTrpOtMN-Keqg3y-waJ1JfMI5oMljeBoweKvzx25_GbWs0oIMM5b57AVmS6DhGljditY0r-dJusj9_kcDjc9jIeB1sOtumrTeQHn8ykiEBKR-fBB5QS8WMI3Fb_h8pwHVVyQQ/s1600/zara_home_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgdgjc1AKaeTrpOtMN-Keqg3y-waJ1JfMI5oMljeBoweKvzx25_GbWs0oIMM5b57AVmS6DhGljditY0r-dJusj9_kcDjc9jIeB1sOtumrTeQHn8ykiEBKR-fBB5QS8WMI3Fb_h8pwHVVyQQ/s1600/zara_home_haul_2.jpg" /></a></div> <h2 style="clear: both; text-align: center;"> I'm back from France!</h2> <div class="separator" style="clear: both; text-align: left;"> You know what the best part of coming home is? Yep, finding a bunch of new packages waiting for you. :) ZARA Home recently started delivering to Slovenia, and since I love their home stuff, I needed to order a few things for our apartment. Here's what I got.</div> <h3 style="clear: both; text-align: center;"> Kitchen/dining</h3> <div class="separator" style="clear: both; text-align: left;"> Let's start the haul with these gorgeous <b>gold coasters</b>. Our living room is kind of oak-gold-white themed, with some grey as well, so these look lovely, mixed with our current bamboo coasters as well. These were in the sale and are out of stock now, but you can check out more coasters <a href="http://www.zarahome.com/si/tableware/coasters-c1293676.html">here</a>.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I also got 4 of the cutest geometrical <b>white mugs</b>, because we need to clean out our mug collection - we have a bunch of them that don't match at all, which bugs me to no end. These are 7€ a pop <a href="http://www.zarahome.com/si/tableware/mugs/diamond-pattern-porcelain-mug-c1293663p6909004.html">here</a>.</div> <div class="separator" style="clear: both;"> <br /></div> <div class="separator" style="clear: both;"> A set of <b>tea towels</b> also found its way into my basket. I find we're always ruining them and they need to be replaced quite fast. Again, these are out of stock, but you can check out more tea towels&nbsp;<a href="http://www.zarahome.com/si/tableware/kitchen-textiles-c1293671.html">here</a>.</div> <h3 style="text-align: center;"> Bathroom</h3> <div class="separator" style="clear: both; text-align: left;"> I got this really nice set <a href="http://www.zarahome.com/si/bathroom/accessories/black-and-white-bathroom-set-c1293648p7191002.html"><b>of a glass and soap dispenser</b></a> in white with a black border. I think they look really chic and they look great in our bathroom. I also got a white soap dispenser for our toilet. The prices for these range around 8€, and I think they look so classy in the bathroom.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I couldn't get past this <b>tissue box</b> with mother of pearl design. It was a bit of a disappointment as it's basically just a mask that you put over a paper box of tissues, but it still looks very pretty. I think it will look nice in my bedroom as well. It was crazy expensive (for what it is) though, so I'd think before ordering. I can't find it on the website but it was around 35€.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> Missing in action is a grey bathmat I just couldn't make look good in the picture, oops! Overall I was pleased with my order - everything's a bit overpriced but the items are lovely.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I also placed a cheeky order on H&amp;M home, which will probably be my next post. I have a tiny The Body Shop haul from the airport as well, so that will be coming in the next few days for all my beauty lovers. Hope you're keeping cool guys - this heat is killing me!</div> <div class="separator" style="clear: both; text-align: center;"> <b><i>What is the last thing your bought for your home?</i></b></div> <div style="text-align: center;"> <br /></div> http://nothinfancyreally.blogspot.com/2016/07/zara-home-haul.htmlnoreply@blogger.com (Živa)9tag:blogger.com,1999:blog-2743690106034386179.post-5922211252216933362Wed, 22 Jun 2016 16:31:00 +00002016-06-22T18:31:29.964+02:00catricechina glazeciateessienail polishrimmelPastel Nail Polish For Summer 2016<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaGKLPRyHUFGXXJFF1kkfkVSPOpkfp5nCej0s9DioSRHjxy3AvygKPSTmbQVFzy5H3QS4lpSJFQSTD64BlkGzTtqTsWVVOiIy7b_aaKvhbXeZXXa5v5Es7A7fJ5X07_DyXEGB3frASSUs0/s1600/spring_2016_best_nail_polish_shades_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaGKLPRyHUFGXXJFF1kkfkVSPOpkfp5nCej0s9DioSRHjxy3AvygKPSTmbQVFzy5H3QS4lpSJFQSTD64BlkGzTtqTsWVVOiIy7b_aaKvhbXeZXXa5v5Es7A7fJ5X07_DyXEGB3frASSUs0/s1600/spring_2016_best_nail_polish_shades_1.jpg" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEisOtUFZFs-nwaJg3Q82pIGsemBt_2R6wHxK8XNoNlvhQ6m-r3bExeULEmQmN3tKEpI-fHpgopuFLxiwdRC7SbUFV-NyXjFLbE90-nLS6T2lP2HNNuqC2t5PG745GRVmgXxUMEq4VbEF87a/s1600/spring_2016_best_nail_polish_shades_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEisOtUFZFs-nwaJg3Q82pIGsemBt_2R6wHxK8XNoNlvhQ6m-r3bExeULEmQmN3tKEpI-fHpgopuFLxiwdRC7SbUFV-NyXjFLbE90-nLS6T2lP2HNNuqC2t5PG745GRVmgXxUMEq4VbEF87a/s1600/spring_2016_best_nail_polish_shades_2.jpg" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <h2 style="clear: both; text-align: center;"> Time for some bright pastels!</h2> <div class="separator" style="clear: both; text-align: left;"> I adore wearing brighter nail polish in spring and summer, so I prepared a round up of my favorite shades for the coming summer months. I'd love to know what you'll be reaching for in these sweltering hot days, as well :) Let's see which ones I've been loving...</div> <h3 style="clear: both; text-align: center;"> The perfect nude</h3> <b>China Glaze Don't Honk Your Thorn</b> has been on my nails a lot. It's one of those <b>nude taupe </b>shades that looks absolutely stunning on tanned skin (not that I'm tan... In fact, my mother kindly pointed out my legs were 'scary pale' just yesterday). This shade is really beautiful though, and it makes nails look longer somehow. Easy to apply as it's quite watery for a pastel, opaque in 2-3 coats. Price is around 6€.<br /> <h3 style="text-align: center;"> Bright as can be</h3> This stunning coral shade is by <b>China Glaze</b>, called <b>Petal to the Metal</b>. A stunning <b>bright pastel</b> - how do they manage that? Those two terms basically don't go together, but it's exactly what this is. A <b>peach coral</b> shade that looks stunning in the summer. I just adore ChG's formula, so easy to apply. Also around 6€.<br /> <h3 style="text-align: center;"> A wash of blue</h3> <b>Catrice 114 The Sky So Fly</b> is a calm blue shade that isn't particularly vibrant, but makes an impact with any outfit. I love the relaxed <b>cool blue which looks chic and modern</b>. And it's a bargain at around 3€ in drugstores! Opaque in 2 coats and easy to apply. I love these watery pastels, so much better to work with and not streaky at all.<br /> <h3 style="text-align: center;"> Blueberry ice-cream</h3> This <b>Rimmel </b>nail polish was a totally random find which cam in a beauty subscription box. The shade is<b> Lovely Lilac</b>, and I love that it's more a muted grey/purple color than some brighter violets. Really pretty and easy to apply. You might notice throughout this post that I am really damn lazy with my nail polish - it better apply well or I'm over it! I think this is around 4€.<br /> <h3 style="text-align: center;"> The perfect cotton candy pink</h3> <div> <b>China Glaze In a Lily Bit</b>. Wham, bam, thank you ma'am. Easy to apply, pretty and chips like a mofo, but I can overlook that fact as it's just such a pretty color, and it's actually not a pain to apply (unlike the next shade). A bargain at around 6€ and one of my top 3 nail polishes of all time!</div> <h3 style="text-align: center;"> Pale pink &amp; pretty</h3> <b>Essie Romper Room</b> is the one I have, but it was limited edition, so you could also get Fiji (but that one is pinker). I adore pastel pink nails, and this one is <b>very very light, with only a hint of pink</b> to it. If you want something more pink, go for the ChG color above. Essies are around 10€ unless you catch them on a 2 for 1 offer, and they're some of my favorite polishes.<br /> <h3 style="text-align: center;"> Peach Pink</h3> <b>Ciaté in Hoopla</b> is the perfect <b>coral/peach/pink</b> color. Light, pastel and so very pretty. It takes a few more coats to make this one opaque, but I just love this brand's packaging (and will admit I mostly buy them for that cute bow). It's around 9€ in drugstores. Check out their gold glitter as well!<br /> <h3 style="text-align: center;"> Forget-me-not</h3> This blue by <b>China Glaze</b> is one of the best polishes in my collection. A muted shade as opposed to those bright, neon &amp; vibrant blues we usually wear, it's so chic and pretty at the same time. The shade is <b>What a Pansy</b> and the price is around 6€.<br /> <br /> <div style="text-align: center;"> <b><i>What is your favorite nail polish of the summer?</i></b></div> http://nothinfancyreally.blogspot.com/2016/06/pastel-nail-polish-for-summer-2016.htmlnoreply@blogger.com (Živa)8tag:blogger.com,1999:blog-2743690106034386179.post-444991089827104732Sun, 19 Jun 2016 14:03:00 +00002016-06-19T16:03:27.871+02:00candlehome decorlifestyleyankee candleSummer 2016 Yankee Candle Haul<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnNUBJ7FGAvXURSiKKpu2l48hZY5ss2v_3mc7fu8DsKYrOWg6gBkvAiG3JJ_Upo85B8u2HP_9I8CXJVRK1sbxXadShJEZFwbBsaKv-q_9ZGNKDal8GRMb48RbAwo-kgSXdPKuYIoAP3xG0/s1600/summer_yankee_candle_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnNUBJ7FGAvXURSiKKpu2l48hZY5ss2v_3mc7fu8DsKYrOWg6gBkvAiG3JJ_Upo85B8u2HP_9I8CXJVRK1sbxXadShJEZFwbBsaKv-q_9ZGNKDal8GRMb48RbAwo-kgSXdPKuYIoAP3xG0/s1600/summer_yankee_candle_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh2SKL4H0pf-AQB6g0b8tflTl7qL2cEotL4CVHEcAITCcU22Ez64dFfrelXyM2FIZ3ZNd7wvZ0KxgJ_pPDbGJbC8IEf13L2YqLn_Z2Z5r-gFXuZK6S-ed2f3q22wTjJsFLi_To9F6Ss45R-/s1600/summer_yankee_candle_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh2SKL4H0pf-AQB6g0b8tflTl7qL2cEotL4CVHEcAITCcU22Ez64dFfrelXyM2FIZ3ZNd7wvZ0KxgJ_pPDbGJbC8IEf13L2YqLn_Z2Z5r-gFXuZK6S-ed2f3q22wTjJsFLi_To9F6Ss45R-/s1600/summer_yankee_candle_haul_2.jpg" /></a></div> <h2 style="clear: both; text-align: center;"> Hello, readers!</h2> <div class="separator" style="clear: both; text-align: left;"> I thought I'd start my comeback with a post about my recent Yankee Candle purchases. I have to say, in the past few years I've grown a little addicted to these candles. I just have to have one burning at all times, and I usually stock up every month or so and buy 4 scents. They last about a week if I burn them daily, every evening, and I couldn't be more thrilled about them. They're definitely my favorite candle brand, though I'd love to try some Diptyque soon as well. Let's see which summery scents I got in June.</div> <h3 style="text-align: center;"> Yankee Candle Fluffy Towels</h3> My boyfriend loves clean cotton scents, and he adores this one especially. I got it for him - since we both work from home now, it's quite <b>relaxing</b> to get into working mode by burning a lovely scent. This is very <b>calming</b>, somewhat <b>sweet</b> and <b>soothing</b>. It also has some fruity (apple, citrus) notes along with lavender. One that guys might like. I bought it <a href="http://www.yankeecandle.si/index.php/yankee-candle-sveca-fluffy-towels-1.html">here</a> for 25€, but it's also available on the <a href="http://www.yankeecandle.com/fragrance/fluffy-towels/_/N-1z140x6">official YC website.</a><br /> <h3 style="text-align: center;"> Yankee Candle Sicilian Lemon</h3> <div style="text-align: left;"> I've had the Lemon Lavender candle before, and the sales associate told me it's one of their bestsellers. However, it's just not a scent I like. The combination of sharp lemon and calming lavender doesn't work for me at all, and I think the two notes clash. I thought a good substitute would be Sicilian Lemon, which is truly a perfect <b>summer</b> scent. <b>Sweet, sharp and citrusy</b>, it helps me relax and get to work! Available <a href="http://www.yankeecandle.si/index.php/yankee-candle-sveca-sicilian-lemon.html">here</a> for 25€. Couldn't find it on the official website - could be a limited edition scent?</div> <h3 style="text-align: center;"> Yankee Candle Peony</h3> <div style="text-align: left;"> I saw my friend Kim get this, and I absolutely had to have it. I'm a huge fan of peonies and this scent transports me right to my grandma's garden. Her peonies bloom in the beginning of June, and she always gives me a bouquet, every single year. I adore this <b>soft floral </b>scent. It's quite <b>powdery</b>, very <b>gentle</b> and inoffensive. Something everyone would like. Available <a href="http://www.yankeecandle.si/index.php/yankee-candle-sveca-peony.html">here</a> for Slovenia, and <a href="http://www.yankeecandle.com/search?Ntt=peony">here</a> for the US. Limited edition, 25€.</div> <h3 style="text-align: center;"> Yankee Candle Summer Scoop</h3> <div style="text-align: left;"> Now, I generally have a rule that I don't buy the same scent twice, but I've broken it a few times... One of the scents is Vanilla Lime, and the other is Summer Scoop. This is probably my favorite YC scent. It's <b>berry ice cream topped with whipped cream</b> and I adore it. It instantly puts me in a good mood. It's thankfully a permanent scent, and if you're gonna get one of these scents, get this one, because you won't regret it. Available <a href="http://www.yankeecandle.si/index.php/yankee-candle-sveca-summer-scoop.html">here</a>, and <a href="http://www.yankeecandle.com/search?Ntt=summer+scoop">here</a> for the US. 25€.</div> <div style="text-align: left;"> <br /></div> <div style="text-align: center;"> I've been burning a few of these scents already and I adore them. I hope this post inspired you to do some shopping of your own... Ooops, didn't mean to be bad to your wallet!</div> <div style="text-align: center;"> <b><i>What's your favorite YC scent?</i></b></div> http://nothinfancyreally.blogspot.com/2016/06/summer-2016-yankee-candle-haul.htmlnoreply@blogger.com (Živa)12tag:blogger.com,1999:blog-2743690106034386179.post-5474390979492863157Sun, 22 May 2016 12:50:00 +00002016-05-22T14:50:10.141+02:00afroditaarmanibody carebourjoiscatricechina glazeconcealeressencehighlighterlipstickmakeupnail polishoriflameperfumeshower gelthe balmSpring 2016 Beauty Picks<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgTMondSx1jBIpN7_slwBKW3YHYA1GilbmBzaEvyxeM_96RjOfDC0ZPQgo8meoUK4kuPb6BFHxTBtE_ux-putNmMAP5r-fcFhAXxPFlXai4eAoTcv6p57_u8vhDnsS5aMzaQgWCmHMZQDII/s1600/spring_2016_beauty_picks_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgTMondSx1jBIpN7_slwBKW3YHYA1GilbmBzaEvyxeM_96RjOfDC0ZPQgo8meoUK4kuPb6BFHxTBtE_ux-putNmMAP5r-fcFhAXxPFlXai4eAoTcv6p57_u8vhDnsS5aMzaQgWCmHMZQDII/s1600/spring_2016_beauty_picks_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhdvmHf0JYZiSCWIDeKE8f8Xyut2pqD7rwlvRfsg4MV1YrBDL0Yc7JncYQz0npJxR-UBi2Lt9RXmVGc22LS_uafc8rrriWF-6NaOur_0VWcXVPvxVCx7ultBwly76naD9f76enuXIuI63Ue/s1600/spring_2016_beauty_picks_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhdvmHf0JYZiSCWIDeKE8f8Xyut2pqD7rwlvRfsg4MV1YrBDL0Yc7JncYQz0npJxR-UBi2Lt9RXmVGc22LS_uafc8rrriWF-6NaOur_0VWcXVPvxVCx7ultBwly76naD9f76enuXIuI63Ue/s1600/spring_2016_beauty_picks_2.jpg" /></a></div> <h3 style="text-align: center;"> Spring is almost over, but I still haven't shown you my beauty picks this season!</h3> <div> I've been loving floral scents and pastels this season and I can't wait to share some of my favorites with you today. I've been liking a really prominent highlight as well. I'm sure you'll fall in love with some of these products too! Let's begin with lipstick...</div> <h4 style="text-align: center;"> Essence Nude &amp; Matte Lipsticks</h4> <div> I've been slowly collecting these over the past few months. They are seriously some of the best lipsticks on the market, and they're incredibly <b>inexpensive </b>as well (2,5-4€ per pop). I love the color <b>Cool Nude</b> especially, and I think the best ones are the nude colors. Strongly recommend these if you can get your hands on them! The nude line is really <b>moisturizing </b>as well, which I love.</div> <h4 style="text-align: center;"> The Balm Mary Loumanizer</h4> <div> Guys, I get the hype. This highlighter is STUNNING. I've been using it pretty much everyday, but beware - this is highlight. On. Fleek! Very <b>prominent </b>color, very <b>intense </b>and beautiful, but if you like a subtle highlight, it's not for you. I just adore it though! It costs around 22€ in Müller and I really recommend it if you're addicted to highlighters - it's a <b>must have</b>!</div> <h4 style="text-align: center;"> Bourjois City Radiance Concealer</h4> <div> I love this product. It's very creamy but at the same time <b>moisturizing </b>and almost gel-like when you apply it. Really <b>great consistency </b>and it gives <b>good coverage</b>, doesn't cake, plus, it feels really pleasant on my skin. I believe the price is around 10€ in drugstores.</div> <div> <h4 style="text-align: center;"> Armani Si EDT</h4> I've talked about this quite a few times now, but I still love it! A more <b>floral</b>, <b>lighter </b>version of the original Si fragrance.<b> Soft, sweet </b>and just perfect with impressive sillage for an EDT. I'd recommend it for spring especially. I got three in a set for 100€ from Sephora.</div> <h4 style="text-align: center;"> Oriflame Bright Bouquet Shower Cream</h4> <div style="text-align: left;"> I've been loving this <b>luxurious </b>shower product from Oriflame. A brand that is too often overlooked in my opinion, as they have some awesome products! I love this <b>floral </b>scented shower cream which <b>lathers </b>up nicely and smells just like spring - perfect for this time of the year. I believe the price is around 8€.</div> <h4 style="text-align: center;"> Afrodita Bouquet of Flowers Body Milk</h4> <div> The perfect product to follow up with after your shower. <b>Delicately scented </b>with a <b>floral </b>perfume mixed with a milky scent, really <b>pampering </b>and again, perfect for spring. Soft and gentle but still very nourishing. I love it, and it's a bargain at around 3-4€ in drugstores.</div> <h4 style="text-align: center;"> Catrice Prime &amp; Fine Beautyfying Primer</h4> <div> I've been absolutely loving this primer. It does it all - gives you a <b>perfect base for foundation</b>, and a really beautiful <b>soft focus finish</b> on your skin. It gives every foundation you apply afterwards a stunning finish. And it's a bargain at around 5€ in drugstores! I think I'll even repurchase this one for summer, it's that great.</div> <h4 style="text-align: center;"> China Glaze in a Lily Bit</h4> <div> Any<b> pastel pink </b>polish is perfect for this time of the year. If you can't get this CG gem, I'd recommend Essie's Fiji though I hope they changed the formulation since I last had it (very thick and streaky). This is a favorite because it <b>applies incredibly well for a pastel color</b>. Beautiful shade and opaque in 2-3 coats, which is surprisingly not the nightmare it usually is. I paid around 3€ on Destination Pretty.</div> <h4 style="text-align: center;"> Catrice The Sky so Fly</h4> A stunning blue, <b>periwinkle </b>color. I just love pastel blues in summer. This says you need to use a base coat on the bottle (I assume a white one?), but it applies perfectly without one. Perfect blue shade and again, <b>easy to apply</b>. And a bargain at around 2,5€.<br /> <br /> <div style="text-align: center;"> There you have it, some of my favorites for this season. Have you tried any of these? I'd love to hear your thoughts on your favorites.</div> <div style="text-align: center;"> <b><i>What is your favorite spring beauty product?</i></b></div> http://nothinfancyreally.blogspot.com/2016/05/spring-2016-beauty-picks.htmlnoreply@blogger.com (Živa)10tag:blogger.com,1999:blog-2743690106034386179.post-573279551165979518Sun, 15 May 2016 13:47:00 +00002016-05-15T15:47:06.209+02:00floralfragrancejimmy chooperfumesweetJimmy Choo Blossom EDP<div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnjU3a2U8ltHRQF9ntKgMD4H2R9o_I0_Z4S0Q0tEMOBBMLcghBhzy-crYQDWHreK_pX_bns4Om2qHCM87b1zTa-nHs13mInNpJzX7V8DOhgQYJnodzZWXuUViEt-lxgUw2Ve3tNKgn5sas/s1600/jimmy_choo_blossom_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnjU3a2U8ltHRQF9ntKgMD4H2R9o_I0_Z4S0Q0tEMOBBMLcghBhzy-crYQDWHreK_pX_bns4Om2qHCM87b1zTa-nHs13mInNpJzX7V8DOhgQYJnodzZWXuUViEt-lxgUw2Ve3tNKgn5sas/s1600/jimmy_choo_blossom_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg-GoHNhHRPWA6K5ySnRQW4t1o7Zohj8cAPlQoY0ONr9tKUDC4RqVcjS3DUGnGnR_keq_RQixk22auRvge8iR09t9vunUt3QfUFa9whtf-n36TTvwTRP_uwmU79nz6e9v16ByoOBN44x5v1/s1600/jimmy_choo_blossom_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg-GoHNhHRPWA6K5ySnRQW4t1o7Zohj8cAPlQoY0ONr9tKUDC4RqVcjS3DUGnGnR_keq_RQixk22auRvge8iR09t9vunUt3QfUFa9whtf-n36TTvwTRP_uwmU79nz6e9v16ByoOBN44x5v1/s1600/jimmy_choo_blossom_2.jpg" /></a></div> <br /> <h3 style="text-align: center;"> Let's start with a long overdue where have I been...</h3> I took a trip to Amsterdam in April, and on the second-to-last day, I fell down some stairs at the metro station. It was the stupidest accident really, but it left me with a broken right hand as well as a shattered wrist. I'm currently wearing a cast up to my shoulder (yep, writing this one-handed!) and will need to keep it on for at least two more weeks. I might also need surgery.<br /> <br /> Personal tragedies aside, I really missed this little blog of mine, so I decided to do a shorter post today to take my mind off this stupid situation! So why not talk about perfume, one of my favorite things in the world? ;)<br /> <br /> When the first <b>Jimmy Choo </b>fragrance came out, I really wanted it, only to discover it had too much patchouli for my taste. But this new edition appropriately named <b>Blossom</b>, seemed right up my alley.<br /> <br /> Blossom is a <b>sweet floral </b>with notes of berries, rose, citrus and musk. Not a groundbreakingly different scent, but lovely nonetheless. It's <b>sweet in a fresh and citrusy way</b>, not cloying and decadent like some deeper sweet scents. The staying power leaves something to be desired, but the sillage is great. Overall an adorable scent perfect for spring and summer, aimed at 20-somethings and younger. Cute!<br /> <br /> You can purchase the fragrance at <a href="http://www.allbeauty.com/search/?q=jimmy+choo+blossom">All Beauty </a>from 44€. I'd recommend it to fans of Prada Candy Eau Florale, it's like Prada's fun, flirty sister!<br /> <div style="text-align: center;"> <b><i>What perfume are you wearing today?</i></b></div> http://nothinfancyreally.blogspot.com/2016/05/jimmy-choo-blossom-edp.htmlnoreply@blogger.com (Živa)6tag:blogger.com,1999:blog-2743690106034386179.post-5925251469881632783Fri, 08 Apr 2016 18:34:00 +00002016-04-08T20:34:29.403+02:00avonbodycaredrugstorelip balmAvon Care Cocoa Butter Line<div class="separator" style="clear: both; text-align: center;"> </div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiiiHyNw7SleKDVTurvYWByGbsP68U2rfgojaeYOaVNw4HRoXUCj60FXI4dc_JPLPuivUGnjoYTb51gn18bYORrYvxVMpg9iPcbm6Hc56hEDQ6PSZdQ8nUYaeiftIO2PYS3T8Ofz4FXF5Eo/s1600/avon_care_cocoa_butter_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiiiHyNw7SleKDVTurvYWByGbsP68U2rfgojaeYOaVNw4HRoXUCj60FXI4dc_JPLPuivUGnjoYTb51gn18bYORrYvxVMpg9iPcbm6Hc56hEDQ6PSZdQ8nUYaeiftIO2PYS3T8Ofz4FXF5Eo/s1600/avon_care_cocoa_butter_1.jpg" /></a></div> <h4 style="text-align: center;"> It rarely happens I fall in love with a whole line of products... But this one is a winner!</h4> <div> I've been loving quite a few Avon products recently, but this line is definitely a firm favorite. It consists of four products, all of which have really manage to impress me. I haven't been using them for too long, so this will be a shorter post, but let's see what my thoughts are...</div> <div> <br /></div> <h3 style="text-align: center;"> Avon Cocoa Butter Rich Cream</h3> <div> Supposedly, you can use this on your face as well as your body, but I prefer it for just <b>bodycare</b>. It's indeed a rich cream but it has a <b>light consistency and sinks in fast</b>. Smells divine and feels like a lighter version of a body butter, but is just as nourishing and moisturizing! Love this stuff... You can buy it <a href="http://www.avon.si/PRSuite/static/p/sl.html?personal-care/body-care/p/0753-4">here </a>for less than 4€!</div> <h3 style="text-align: center;"> Avon Cocoa Butter Hand Cream</h3> <div> I just love anything with cocoa butter and having a hand cream with that ingredient means it's extremely nourishing and great for <b>cuticles </b>as well. I love using this <b>before bed </b>as my hands are really soft when I wake up. A bit too much to put in my purse, but a love nonetheless! Available <a href="http://www.avon.si/PRSuite/static/p/sl.html?personal-care/hand-care/p/4049-3">here </a>for less than 2€.</div> <h3 style="text-align: center;"> Avon Cocoa Butter Lip Balm</h3> <div> I can't seem to find this on the Avon website, but this is a great lip balm in a <b>squeezy </b>tube. I like to use it as a <b>prevantative </b>lip balm (when my lips are chapped already, I prefer Blistex). It's very nourishing - and it tastes great... Not sure I should be eating is as much as I do. :P I think the price is around 4€ if you can still find it anywhere!</div> <h3 style="text-align: center;"> Avon Cocoa Butter Body Lotion</h3> <div> Another great product with a surprisingly <b>light </b>consistency, given that it contains Cocoa Butter. <b>Pleasant</b>, light and <b>cooling</b>, with a really nice scent just like the rest of the range. I really love this stuff. Available here for a little over 4€.</div> <div> <br /></div> <div> My only hope for this line is that they would add some more products - perhaps an in-shower lotion like Nivea has? That product is one of my favorites and I'd love to see more brands attempt to make something similar. A body scrub would also be lovely, as well as a lip scrub... Ah, I hope they bring out more product as I really am a huge fan of this line!</div> <div> <br /></div> <div> Blogger of the day is <b>Laura </b>from <a href="http://www.buynowbloglater.com/">Buy Now, Blog Later.</a> Some of you old school YT peeps may know Laura as lollipop26, and if you're anything like me, you were also addicted to her OG Youtube videos in the olden days (god, I'm old). Now, I absolutely ADORE Laura's blog and Instagram, and her fashion choices are a daily inspiration! Can't get enough of her content, and she's so stunning as well and seems like a total darling. I've followed her for years and don't see myself stopping any time soon!</div> <div style="text-align: center;"> <b><i>What is your favorite product with cocoa butter?</i></b></div> http://nothinfancyreally.blogspot.com/2016/04/avon-care-cocoa-butter-line.htmlnoreply@blogger.com (Živa)8
This XML file does not appear to have any style information associated with it. The document tree is shown below.
<rss xmlns:atom="http://www.w3.org/2005/Atom" xmlns:openSearch="http://a9.com/-/spec/opensearchrss/1.0/" xmlns:blogger="http://schemas.google.com/blogger/2008" xmlns:georss="http://www.georss.org/georss" xmlns:gd="http://schemas.google.com/g/2005" xmlns:thr="http://purl.org/syndication/thread/1.0" version="2.0">
<channel>
<atom:id>tag:blogger.com,1999:blog-2743690106034386179</atom:id>
<lastBuildDate>Wed, 06 Nov 2024 03:05:59 +0000</lastBuildDate>
<category>makeup</category>
<category>skincare</category>
<category>drugstore</category>
<category>perfume</category>
<category>fragrance</category>
<category>hair</category>
<category>bodycare</category>
<category>shopping</category>
<category>nail polish</category>
<category>home decor</category>
<category>high end</category>
<category>random</category>
<category>lipstick</category>
<category>candle</category>
<category>sweet</category>
<category>catrice</category>
<category>budget</category>
<category>fashion</category>
<category>cooking</category>
<category>haul</category>
<category>haircare</category>
<category>floral</category>
<category>foundation</category>
<category>interior design</category>
<category>yankee candle</category>
<category>bourjois</category>
<category>essence</category>
<category>blogging</category>
<category>books</category>
<category>favourites</category>
<category>fall</category>
<category>natural</category>
<category>MAC</category>
<category>balea</category>
<category>giveaway</category>
<category>vichy</category>
<category>beauty</category>
<category>blusher</category>
<category>fruity</category>
<category>maybelline</category>
<category>personal</category>
<category>ren</category>
<category>summer</category>
<category>Lush</category>
<category>Yves Rocher</category>
<category>acne</category>
<category>blush</category>
<category>essie</category>
<category>eyeshadow</category>
<category>kiko</category>
<category>lipgloss</category>
<category>makeup revolution</category>
<category>rimmel</category>
<category>tips</category>
<category>afrodita</category>
<category>jewelry</category>
<category>lifestyle</category>
<category>online shopping</category>
<category>oriflame</category>
<category>revlon</category>
<category>spring</category>
<category>concealer</category>
<category>french pharmacy</category>
<category>loreal</category>
<category>mascara</category>
<category>pink</category>
<category>winter</category>
<category>avon</category>
<category>britney spears</category>
<category>empties</category>
<category>garnier</category>
<category>healthy</category>
<category>la roche posay</category>
<category>nails</category>
<category>DIY</category>
<category>Real Techniques</category>
<category>armani</category>
<category>body care</category>
<category>cartier</category>
<category>china glaze</category>
<category>corine de farme</category>
<category>dessert</category>
<category>dr scheller</category>
<category>estee lauder</category>
<category>favorites</category>
<category>fresh</category>
<category>got2b</category>
<category>green beauty</category>
<category>guerlain</category>
<category>guest post</category>
<category>happy-go-healthy girl</category>
<category>have you discovered</category>
<category>highlighter</category>
<category>home</category>
<category>john frieda</category>
<category>lips</category>
<category>luxury</category>
<category>models own</category>
<category>nude</category>
<category>orly</category>
<category>outfit</category>
<category>palette</category>
<category>recipe</category>
<category>redken</category>
<category>shoes</category>
<category>shower gel</category>
<category>spicy</category>
<category>the body shop</category>
<category>the valentine project</category>
<category>tigi</category>
<category>urban decay</category>
<category>weleda</category>
<category>wishlist</category>
<category>accessories</category>
<category>anastasia</category>
<category>artistry</category>
<category>aussie</category>
<category>brush</category>
<category>citrus</category>
<category>clarins</category>
<category>deborah</category>
<category>dove</category>
<category>eyebrows</category>
<category>food</category>
<category>givenchy</category>
<category>if you only buy one things this week</category>
<category>juicy couture</category>
<category>lavera</category>
<category>mama nature</category>
<category>manicure</category>
<category>marc jacobs</category>
<category>milani</category>
<category>musky</category>
<category>neutrogena</category>
<category>notd</category>
<category>powder</category>
<category>the balm</category>
<category>vera wang</category>
<category>& other stories</category>
<category>BECCA</category>
<category>Christmas</category>
<category>FOTD</category>
<category>H&M</category>
<category>Tilen Time Thursday</category>
<category>aquolina</category>
<category>asian cosmetics</category>
<category>barry m</category>
<category>bioderma</category>
<category>blogs</category>
<category>blogs of the week</category>
<category>bocassy</category>
<category>brushes</category>
<category>burts bees</category>
<category>candles</category>
<category>caudalie</category>
<category>cece of sweden</category>
<category>chloe</category>
<category>ciate</category>
<category>click2chic</category>
<category>collection</category>
<category>cruelty free</category>
<category>dieting</category>
<category>drogerie markt</category>
<category>dry hair</category>
<category>edp</category>
<category>edt</category>
<category>elf</category>
<category>etude house</category>
<category>event</category>
<category>fragrance direct</category>
<category>i love</category>
<category>jimmy choo</category>
<category>kardashian beauty</category>
<category>katy perry</category>
<category>korres</category>
<category>l'erbolario</category>
<category>l'oreal</category>
<category>lip balm</category>
<category>lolita lempicka</category>
<category>matte</category>
<category>max factor</category>
<category>men</category>
<category>nanshy</category>
<category>neutral</category>
<category>nina ricci</category>
<category>nivea</category>
<category>nyx</category>
<category>ogx</category>
<category>oily skin</category>
<category>opi</category>
<category>organisation</category>
<category>photography</category>
<category>post ideas</category>
<category>prada</category>
<category>preview</category>
<category>primark</category>
<category>primer</category>
<category>problematic skin</category>
<category>project 10 pan</category>
<category>reading</category>
<category>satinique</category>
<category>shower</category>
<category>sleek</category>
<category>subrina professional</category>
<category>sunday riley</category>
<category>tag</category>
<category>too faced</category>
<category>una brennan</category>
<category>upcoming</category>
<category>victoria's secret</category>
<category>wardrobe</category>
<category>zara</category>
<category>zuii</category>
<category>Amway</category>
<category>Cosmopolitan</category>
<category>L'Occitane</category>
<category>NARS</category>
<category>Notino</category>
<category>Youtube</category>
<category>advertisers</category>
<category>advertising</category>
<category>agent provocatuer</category>
<category>alpstories</category>
<category>alverde</category>
<category>antipodes</category>
<category>apartment</category>
<category>astor</category>
<category>autumn</category>
<category>babushka</category>
<category>back to school</category>
<category>bag</category>
<category>base</category>
<category>bath</category>
<category>bb cream</category>
<category>bedhead</category>
<category>benecos</category>
<category>benefit</category>
<category>best kept secrets</category>
<category>body mist</category>
<category>bomb cosmetics</category>
<category>breakfast</category>
<category>brows</category>
<category>bvglari</category>
<category>cake</category>
<category>candlelite</category>
<category>chanel</category>
<category>charles worthington</category>
<category>charlotte tilbury</category>
<category>cheeks</category>
<category>chocolate</category>
<category>ciaté</category>
<category>clinique</category>
<category>cocoa brown</category>
<category>cold weather</category>
<category>collistar</category>
<category>colorama</category>
<category>combination skin</category>
<category>comparision</category>
<category>conditioner</category>
<category>contact lenses</category>
<category>contest</category>
<category>cookies</category>
<category>cooking schmooking</category>
<category>coral</category>
<category>cult beauty</category>
<category>damaged hair</category>
<category>davidoff</category>
<category>dehydrated skin</category>
<category>delarom</category>
<category>design</category>
<category>disappointing</category>
<category>dkny</category>
<category>drink</category>
<category>dry skin</category>
<category>eau intense</category>
<category>ebook</category>
<category>ecosse</category>
<category>elie saab</category>
<category>elizabeth arden</category>
<category>eos</category>
<category>essentials</category>
<category>evening</category>
<category>eyeliner</category>
<category>feel unique</category>
<category>feelunique</category>
<category>frgarance</category>
<category>fruit</category>
<category>gift guide</category>
<category>glade</category>
<category>green</category>
<category>green line</category>
<category>hair care</category>
<category>hair mask</category>
<category>halloween</category>
<category>hand cream</category>
<category>heidi swapp</category>
<category>highligter</category>
<category>hm</category>
<category>honey</category>
<category>i heart makeup</category>
<category>indian summer</category>
<category>inika</category>
<category>international</category>
<category>isadora</category>
<category>lancome</category>
<category>lanvin</category>
<category>le couvent des minimes</category>
<category>lily flame</category>
<category>lip butter</category>
<category>lipliner</category>
<category>liquid lipstick</category>
<category>living room</category>
<category>lotion</category>
<category>madonna</category>
<category>magazines</category>
<category>malta</category>
<category>marlenha</category>
<category>melvita</category>
<category>metallic</category>
<category>micellar solution</category>
<category>minimal</category>
<category>miss copycat</category>
<category>monoi</category>
<category>morning</category>
<category>muji</category>
<category>mulondon</category>
<category>murad</category>
<category>music</category>
<category>must have</category>
<category>natural collection</category>
<category>new adult</category>
<category>notebooks</category>
<category>olaz</category>
<category>organic</category>
<category>origins</category>
<category>ouai</category>
<category>paco rabanne</category>
<category>paco rabbane</category>
<category>parfums d'orsay</category>
<category>patchouli</category>
<category>paula's choice</category>
<category>percy & reed</category>
<category>phi</category>
<category>pizza</category>
<category>planner</category>
<category>planning</category>
<category>princess</category>
<category>red</category>
<category>review</category>
<category>room</category>
<category>salma</category>
<category>sample sunday</category>
<category>schwarzkopf</category>
<category>secret kiss</category>
<category>sensai</category>
<category>sephora</category>
<category>shalimar</category>
<category>shampoo</category>
<category>share the love</category>
<category>shiseido</category>
<category>si</category>
<category>sites</category>
<category>snack</category>
<category>soap</category>
<category>soap and glory</category>
<category>soapy</category>
<category>soup</category>
<category>sunglasses</category>
<category>swap</category>
<category>swatches</category>
<category>tangle angel</category>
<category>terry de gunzburg</category>
<category>timothy dunn</category>
<category>tom ford</category>
<category>tour</category>
<category>travel</category>
<category>tv</category>
<category>update</category>
<category>vegan</category>
<category>video</category>
<category>visiomax</category>
<category>wax tarts</category>
<category>ysl</category>
<category>yummy</category>
<category>zoella</category>
<category>zoeva</category>
<title>Nothin' Fancy. Really.</title>
<description>A lifestyle blog.</description>
<link>http://nothinfancyreally.blogspot.com/</link>
<managingEditor>noreply@blogger.com (Živa)</managingEditor>
<generator>Blogger</generator>
<openSearch:totalResults>418</openSearch:totalResults>
<openSearch:startIndex>1</openSearch:startIndex>
<openSearch:itemsPerPage>25</openSearch:itemsPerPage>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-6951227598878596988</guid>
<pubDate>Thu, 10 Dec 2020 10:22:00 +0000</pubDate>
<atom:updated>2020-12-10T11:22:44.454+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">candles</category>
<category domain="http://www.blogger.com/atom/ns#">fragrance</category>
<category domain="http://www.blogger.com/atom/ns#">perfume</category>
<category domain="http://www.blogger.com/atom/ns#">random</category>
<title>A Random's Girl's Best Of 2020: Candles, Perfumes and Everything That Smells Nice, oh my!</title>
<description><p></p><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQ4qrltzv1QWTIjGOlNMyTdLXMIYwoVLpswVoP_whZHj36P-wSO0xxINYqU2gbUUTM-ELb7-Virey5Ovy138TAe4sflU60vYJDzlTKytgoY8VYmO5Ek9gEyWh0jFKqGSnR1RMnsr0569Oo/s2048/IMG_9617.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQ4qrltzv1QWTIjGOlNMyTdLXMIYwoVLpswVoP_whZHj36P-wSO0xxINYqU2gbUUTM-ELb7-Virey5Ovy138TAe4sflU60vYJDzlTKytgoY8VYmO5Ek9gEyWh0jFKqGSnR1RMnsr0569Oo/s16000/IMG_9617.jpg" /></a></div>&nbsp;<div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjYDGEAqpWMFmiVr1Sgd8-S1D315JhwP6cXALvuw4P2R0gonsnzvZQnIVrXoa_el9QQc2jydyJqbz-WmEv6CvDyRA9LxbPYLOgREPMuZk7FRLx10CWLQAlvXxPf8klkRN9me7cmpJ8Ll4_8/s2048/IMG_9618.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1536" data-original-width="2048" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjYDGEAqpWMFmiVr1Sgd8-S1D315JhwP6cXALvuw4P2R0gonsnzvZQnIVrXoa_el9QQc2jydyJqbz-WmEv6CvDyRA9LxbPYLOgREPMuZk7FRLx10CWLQAlvXxPf8klkRN9me7cmpJ8Ll4_8/s16000/IMG_9618.jpg" /></a></div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">You (hopefully) know I'm a fragrance addict, right? Today I compiled a list of my favorites from 2020 - things that I've found this year or that I've been using for years beforehand. These are all products that get my kiss of approval and I think you'd love them as well!</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h2 style="clear: both; text-align: center;">Let's see what I've been loving...</h2><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.ilkos.si/" target="_blank">Ilkos Candles</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">This was a very recent discovery but I LOVE these candles. They are inexpensive but very heavily scented so they really make any room smell amazing. They have a special Christmas collection available right now which is just wonderful. I can't recommend any specific scent because I've tried most of them and loved them all! I can't wait to get more candles from them.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/jennifer-lopez/glow-by-jlo-toaletna-voda-za-zenske/" target="_blank">J.Lo Glow EDT</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">If you need a scent that makes you feel instantly refreshed and ready to start the day, this is the one for you. It smells like baby powder and soap and it's so crisp and fresh and just perfect, I adore it. I go through this like water but it is actually really strong and lasts quite a while. Plus, it's a total bargain!</div><h3 style="clear: both; text-align: center;"><br />Profissimo Perfume Oil Apple Cinnamon</h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">I've been really into using my diffuser lately (I'll make a separate post about this) and this oil has been one of my absolute favorites. You can grab it in Drogerie Markt for the bargainous price of under 2€. Ridiculous! It's perfect for this season and a great alternative to expensive candles.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/paco-rabanne/olympea-legend-parfumska-voda-za-zenske/" target="_blank">Paco Rabanne Olympea Legend EDP</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">This is my favorite perfume of all time. I get compliments on it from strangers. STRANGERS! I don't know about you but that's never happened to me before with any other scent. This is lick-your-fingers good. Sweet, sexy and opulent. It's also the boyfriend's favorite scent. I can't get over this one and this is my 2nd bottle.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/paco-rabanne/pure-xs-for-her-parfumska-voda-za-zenske/" target="_blank">Paco Rabanne Pure XS EDP</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">Another favorite from Mr. Rabanne. This is a bit more generic, but still sexy. Sweet, heavy, opulent, comforting. I adore this scent and have been wearing almost daily since it got cold (I save Olympea for special occasions). It makes me feel cozy and warm and I just adore it.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.zoflora.co.uk/" target="_blank">Zoflora</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">A recent find, but an invaluable one! Zoflora is a British disinfectant cleaning... thing that you need to dilute (because otherwise it's flammable!) I use it for anything and everything - wiping down surfaces mostly. You can also check Youtube for tips on how to use it, there are soooo many uses for it! I'm planning on getting a steam mop so I can clean the floors with it. It smells amazing and there are so many scents to pick from! Linen Fresh is my fav for the bedroom and Warm Cinnamon is my seasonal favorite for the rest of the apartment.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/armani/acqua-di-gioia-parfumska-voda-za-zenske/" target="_blank">Armani Acqua di Gioia EDP</a></h3><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">If you've been reading my blog for a while, you're probably well aware this is a long-time favorite of mine. I adore this perfume. It's fresh, sweet, sexy and lasts pretty well. I even have an engraved bottle now that I got for my birthday from my in-laws! You absolutely need this perfume for summer. It's my signature scent!</div><div class="separator" style="clear: both; text-align: center;"><br /></div><h3 style="clear: both; text-align: center;"><a href="https://www.notino.si/kim-kardashian/pure-honey-parfumska-voda-za-zenske/" target="_blank">Kardashian Pure Honey EDP</a></h3><div class="separator" style="clear: both; text-align: center;">Listen here. I didn't buy this because I'm a Kardashian fan. I bought it because I wanted a honey scent that was more honeycomb than honeysuckle. And man, does this one deliver. It's deep, special, different and sweet in a totally unique way. It's cozy, comfy, heavy, thick. I absolutely adore this scent for layering as well. And it's soooo inexpensive.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;">So those have been all my favorite scents of 2020. I hope you found some gems in this post!</div><h2 style="clear: both; text-align: center;">I'd love to know - what was your favorite scented product of 2020?</h2><p></p></description>
<link>http://nothinfancyreally.blogspot.com/2020/12/a-randoms-girls-best-of-2020-candles.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQ4qrltzv1QWTIjGOlNMyTdLXMIYwoVLpswVoP_whZHj36P-wSO0xxINYqU2gbUUTM-ELb7-Virey5Ovy138TAe4sflU60vYJDzlTKytgoY8VYmO5Ek9gEyWh0jFKqGSnR1RMnsr0569Oo/s72-c/IMG_9617.jpg" height="72" width="72"/>
<thr:total>0</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-5252537668904899251</guid>
<pubDate>Wed, 09 Dec 2020 10:39:00 +0000</pubDate>
<atom:updated>2020-12-09T11:45:07.053+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">books</category>
<category domain="http://www.blogger.com/atom/ns#">music</category>
<category domain="http://www.blogger.com/atom/ns#">random</category>
<category domain="http://www.blogger.com/atom/ns#">tv</category>
<title>A Random Girl's Best Of 2020: Books, Netflix and Music</title>
<description><p style="text-align: center;"></p><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaHFrJL16pfhHxy5IOe6K7dGp-DwSPq-0Q9d5OqfprADSNTaDhBq65vvITa2U-eGADboqX0ytUy6eIj3nSiTZYhyg8kJe_coiBjJjPleoyeC39hIPIhirMHhHkLEL-79TW5bfnM5Htx84b/s2048/IMG_9608.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaHFrJL16pfhHxy5IOe6K7dGp-DwSPq-0Q9d5OqfprADSNTaDhBq65vvITa2U-eGADboqX0ytUy6eIj3nSiTZYhyg8kJe_coiBjJjPleoyeC39hIPIhirMHhHkLEL-79TW5bfnM5Htx84b/s16000/IMG_9608.jpg" /></a></div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEglC785zmZylBpLuJjvhDK70yVevfWkLZCLLShGr60L_Z3YICPCDy0UzwxPmFoR9Tj0dTJfepSca4sANif62cmAVQAujSZa4ZQ8MuMlJqFCHxOI7TV2W-2YczaGcSnvgrFO97bHeokHyPdL/s2048/IMG_9610.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEglC785zmZylBpLuJjvhDK70yVevfWkLZCLLShGr60L_Z3YICPCDy0UzwxPmFoR9Tj0dTJfepSca4sANif62cmAVQAujSZa4ZQ8MuMlJqFCHxOI7TV2W-2YczaGcSnvgrFO97bHeokHyPdL/s16000/IMG_9610.jpg" /></a></div><br />&nbsp;<p></p><p style="text-align: center;">I love all kinds of media and like probably everyone else this year, I, too, have binged Netflix hard. I've got some recommendations on my favorites of this year below. I would love to know what you enjoyed this year in the comments below!</p><p style="text-align: center;"><br /></p><h1 style="text-align: center;">Netflix </h1><div><br /></div><h3 style="text-align: center;">Breaking Bad</h3><div><br /></div><div style="text-align: center;">This year, my boyfriend forced me to watch this show. I'd been dreading it for years. But then we started. And from the first episode I was totally hooked! We watched the whole show over a couple of months and I cried A LOT while watching it. Embarrasingly-a-lot, to be exact. Boyfriend wants to carry on with Saul but I'm being a brat. Maybe next year.</div><div style="text-align: center;"><br /></div><div><h3 style="text-align: center;">Brooklyn Nine Nine</h3></div><div><br /></div><div style="text-align: center;">Andy Samberg is my favorite! OMG this show is so good. If you miss sitcoms like Friends, Parks and Rec and The Office, you're gonna love this cop show. It's short, funny, not insensitive, and really adorable. I love it.</div><div style="text-align: center;"><br /></div><h3 style="text-align: center;">Drag Race</h3><div><br /></div><div style="text-align: center;">I didn't get it at first. 14 US seasons, 1 UK season (several watched twice, some three or four times...) later and I'm a convert. I fucking LOVE this show. My favorite contestants? I'm so glad you asked. I LOVE: Sasha Velour, Violet Tchatchki, Gigi Gorgeous (#robbed), Brooklyn Hytes, Trinity, Shea and Pearl! I hope there's a new season soon PLEASE!</div><div style="text-align: center;"><br /></div><h3 style="text-align: center;">Emily in Paris</h3><div><br /></div><div style="text-align: center;">I watched this in 3 days. Then I watched it again. And then I made the boyfriend watch it with me and even he's not complaining about it that much so THERE. It's cute. Like Gossip Girl for adults. In Paris instead of New York. And with more di...</div><div style="text-align: center;"><br /></div><h1 style="text-align: center;">Books</h1><div><br /></div><div style="text-align: center;"><h3><a href="https://www.bookdepository.com/Tokyo-Bicycle-Bakery-Su-Young-Lee/9798677593451?ref=grid-view&amp;qid=1607510695157&amp;sr=1-4" target="_blank">The Tokyo Bicycle Bakery</a></h3><div><br /></div><div>I picked this up randomly and fell in love. Magical realism that's so gentle and bittersweet you can almost taste the moment before it's gone. It has yummy descriptions of food, a beautiiiiiiful story, and it made me cry. Buy it. Read it. Love it. P.S. If you were crazy about that Johny Depp flick Chocolat back in the day YOU WILL LOVE THIS.</div><div><br /></div><h3><a href="https://www.bookdepository.com/We-Are-Okay-Nina-LaCour/9780142422939?ref=grid-view&amp;qid=1607510683625&amp;sr=1-1" target="_blank">We Are Okay</a></h3><div><br /></div><div>OMG listen why do all these books make me cry? It deals with grief and it hits hard. But it's beautiful and important. It helped me come to terms with things I've held back for years. I loved it and cannot wait to pick up more of Nina LaCour's books.</div><div><br /></div><h3><a href="https://www.bookdepository.com/Little-Deaths-Emma-Flint/9781509826582?ref=grid-view&amp;qid=1607510670782&amp;sr=1-1" target="_blank">Little Deaths</a></h3><div><br /></div><div>I know my friend <a href="https://www.instagram.com/ninainthespring" target="_blank">Nina </a>didn't enjoy this one so much (YES I stalked you on Goodreads. Whatchu gonna do about it?) but I loved it... It was dark, super atmospheric (hot NYC summer, oppressive, grungy, thick with cigar smoke) and kept me guessing. I'm so excited for this author to write more.</div><div><br /></div><div><h1>Music</h1></div><div><br /></div><div>Like everyone and their dog, I got my Spotify round-up and shared it in an embarrassingly high amount of places given that nobody cares. Anyway, I don't know why I was so insistent on posting everywhere because it's shameful AF. My #1 genre is Pop. I shouldn't be surprised because Britney is queen #FreeBritney #LeaveBritneyAlone #OtherTrendingBritneyHashtags But if you're looking for some good new music, I recommend Sleepy Fish (lo fi) as well as Qveen Herby who was my obsession for the year.</div><div><br /></div><h3>That's the media that's shaped my year! What have you been enjoying music, Netflix and reading-wise? Tell me in the comments!</h3><div><br /></div></div></description>
<link>http://nothinfancyreally.blogspot.com/2020/12/a-random-girls-best-of-2020-books.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaHFrJL16pfhHxy5IOe6K7dGp-DwSPq-0Q9d5OqfprADSNTaDhBq65vvITa2U-eGADboqX0ytUy6eIj3nSiTZYhyg8kJe_coiBjJjPleoyeC39hIPIhirMHhHkLEL-79TW5bfnM5Htx84b/s72-c/IMG_9608.jpg" height="72" width="72"/>
<thr:total>0</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-6778510448424900497</guid>
<pubDate>Tue, 08 Dec 2020 08:45:00 +0000</pubDate>
<atom:updated>2020-12-09T11:16:54.857+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">drugstore</category>
<category domain="http://www.blogger.com/atom/ns#">favorites</category>
<category domain="http://www.blogger.com/atom/ns#">high end</category>
<category domain="http://www.blogger.com/atom/ns#">makeup</category>
<title>A Random's Girl's Best Of 2020: Makeup Favorites</title>
<description><p style="text-align: center;"></p><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgY18q3k1JYmDwKG-AboIBxymNav4jaP_BtxEqzoIRqc2u0Df-uWlFzvwqA4oEtqBnVRoJYZyMADp2kspDB6raukkfEViQ4VqrFbkx_QBh9lLXP_Eub9AsEajpQK7mCpU2mmfvbceW1gEOH/s2048/IMG_9499.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgY18q3k1JYmDwKG-AboIBxymNav4jaP_BtxEqzoIRqc2u0Df-uWlFzvwqA4oEtqBnVRoJYZyMADp2kspDB6raukkfEViQ4VqrFbkx_QBh9lLXP_Eub9AsEajpQK7mCpU2mmfvbceW1gEOH/s16000/IMG_9499.jpg" /></a></div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUFd8XIjN5M5zVevMhnlGiEGxIwffHGF8iONG09fRXBJUlf7Jegc-9tymmVpO8WaIRIeDPCV6QBWTMElYDuxncgzEDWF2-oopivg0VYY5yu3FXEGGyL_RLgEoECZ_B5K_zkgu1JzXBFBlj/s2048/IMG_9500.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1536" data-original-width="2048" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUFd8XIjN5M5zVevMhnlGiEGxIwffHGF8iONG09fRXBJUlf7Jegc-9tymmVpO8WaIRIeDPCV6QBWTMElYDuxncgzEDWF2-oopivg0VYY5yu3FXEGGyL_RLgEoECZ_B5K_zkgu1JzXBFBlj/s16000/IMG_9500.jpg" /></a></div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgxFyNypLST1Hi11BnagLv3iqWBMxvxMwGavk1fZGmT7FEFuX-6WIFW8E7fkuQ10wr-lqotzLuTCF8iiH6UNwM-Ss9kmT5TLTPhemeJKsj20nP4fHG62HGA7EldUWTMwOJA4uGBwnEtoIqG/s2048/IMG_9504.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="2048" data-original-width="2048" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgxFyNypLST1Hi11BnagLv3iqWBMxvxMwGavk1fZGmT7FEFuX-6WIFW8E7fkuQ10wr-lqotzLuTCF8iiH6UNwM-Ss9kmT5TLTPhemeJKsj20nP4fHG62HGA7EldUWTMwOJA4uGBwnEtoIqG/s16000/IMG_9504.jpg" /></a></div><br />&nbsp;<p style="text-align: center;">Time to talk makeup! Honestly, I feel like I'm stuck in a rut with my makeup. It always looks the same! I think I need to figure out something to change because I'm getting sooo bored of painting the same face every day.&nbsp;</p><p style="text-align: center;"><br /></p><h3 style="text-align: center;">Anywayyyyyy, if you want to see my favorite products of 2020, keep reading!</h3><div><br /></div><h4 style="text-align: center;"><a href="https://eu.feelunique.com/p/Essence-Lash-Princess-False-Lash-Effect-Mascara-12ml?q=essence%20false%20lash&amp;q_typ=a&amp;q_cat=product&amp;q_dep=Makeup%2CEyes" target="_blank">Essence Lash Princess False Lash Effect Mascara</a></h4><div><br /></div><div style="text-align: center;">Oh Essence, how I love thee. <b>Affordable, adorable and irresistible</b>, that should be their slogan. I just adore this mascara. It makes my lashes so <b>longggg</b>, and super voluminous too if I do a second coat. I wouldn't layer it over 2 times though. Ya girl has had some very clumpy/Twiggy lash experiences with 3 coats...&nbsp;</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://eu.feelunique.com/p/Milani-Baked-Blush-35g?q=luminoso&amp;q_typ=f" target="_blank">Milani Luminoso Baked Powder Blush</a></h4><div><br /></div><div style="text-align: center;">Can you say #OldieGoldie? This used to be everyone's favorite and I used to buy Milani from a Polish website when you couldn't get it anywhere else. #EmphasisOnTheOldie This shade is the <b>perfect peach and brightens cheeks for a beautiful glow</b>. Packaging could be better, though.</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://eu.feelunique.com/p/NYX-Professional-Makeup-Cant-Stop-Wont-Stop-24-Hour-Foundation-30ml?q=can%27t%20stop%20won%27t%20stop&amp;q_typ=a&amp;q_cat=product&amp;q_dep=Makeup%2CComplexion" target="_blank">NYX Can't Stop Won't Stop Full Coverage Foundation</a></h4><div><br /></div><div style="text-align: center;">Okay so, I finally found a shade that's too light for me! After years of being always-slightly-too-orange, I am amazed that I can now look 3 shades lighter from the neck up! Okay but seriously, this is really <b>thick and covers up a multitude of sins</b> including that Sunday you decided to say fuck it and have a glass of wine too many, and you have a Zoom meeting in 15 minutes, and you slap this on, and suddenly it's like, dark circles <i>who</i>? It's a great foundation is my point.</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://www.beautybay.com/p/bh-cosmetics/brilliance-bronzers/golden-gal/" target="_blank">BH Cosmetics Brilliance Bronzer in Golden Gal</a></h4><div><br /></div><div style="text-align: center;">Listen, I don't know how to use bronzer. Usually I grab the one brush I don't know what to use for, kind of swirl it in there, put it in random places and hope for the best. BUT this has been my best friend and made me look SO much more alive. If NYX gives the perfect canvas, this adds <b>dimension</b>. It's a beautiful bronzer. I'm impressed!</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://eu.feelunique.com/p/Real-Techniques-Miracle-Complexion-Sponge-Duo-Pack?q=miracle%20%20c&amp;q_typ=a&amp;q_cat=product&amp;q_dep=Makeup%2CComplexion" target="_blank">Real Techniques Miracle Complexion Sponge</a></h4><div><br /></div><div style="text-align: center;">It's just the best one out there. I love the BeautyBlender but 1. this cheaper 2. this harder and better to apply foundation with. I keep buying the double packs like an addict. They're so squishy, Imgonnadie!</div><div style="text-align: center;">I use this to <b>apply foundation</b>. And if you didn't know like me, you're supposed to <b>wet them</b> before you apply.&nbsp;</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://www.maccosmetics.com/product/13854/36169/products/makeup/lips/lipstick/cremesheen-lipstick#!/shade/Cr%C3%A8me_In_Your_Coffee" target="_blank">MAC Creme in Your Coffee Lipstick</a></h4><div><br /></div><div style="text-align: center;">This is such a gorgeous<b> neutral, creamy</b> shade. I LOVE how it looks in the fall and winter. For spring, summer, it's a little too dark for me. BUT for a S/S option, I love...</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://www.charlottetilbury.com/us/product/matte-revolution-lipstick-pillowtalk" target="_blank">Charlotte Tilbury Bond Girl Lipstick</a></h4><div><br /></div><div style="text-align: center;">This gorgeous color is a little more on the <b>pink, vibrant nude</b> side and looks beautiful in all seasons. It's creamy and very opaque. Worth the money!</div><div style="text-align: center;"><br /></div><h4 style="text-align: center;"><a href="https://www.sephora.com/product/everlasting-love-liquid-lipstick-P384954" target="_blank">Kat Von D Liquid Lipstick in Lolita</a></h4><div><br /></div><div style="text-align: center;">This is the easiest shade to wear. It <b>dries fast and looks good without smudging </b>until you eat or drink, and even then it fades in a pretty way. This is my favorite liquid lipstick of all time.</div><div style="text-align: center;"><br /></div><div style="text-align: center;"><br /></div><div style="text-align: center;">I thought about including more products but I really think this is the best of the best. If you have tried any of them, I'd love to know your thoughts.</div><div style="text-align: center;"><br /></div><h2 style="text-align: center;">What was your standout makeup product of 2020?</h2></description>
<link>http://nothinfancyreally.blogspot.com/2020/12/a-randoms-girls-best-of-2020-makeup.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgY18q3k1JYmDwKG-AboIBxymNav4jaP_BtxEqzoIRqc2u0Df-uWlFzvwqA4oEtqBnVRoJYZyMADp2kspDB6raukkfEViQ4VqrFbkx_QBh9lLXP_Eub9AsEajpQK7mCpU2mmfvbceW1gEOH/s72-c/IMG_9499.jpg" height="72" width="72"/>
<thr:total>0</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-4681621451969728254</guid>
<pubDate>Mon, 07 Dec 2020 08:39:00 +0000</pubDate>
<atom:updated>2020-12-07T09:42:39.042+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">beauty</category>
<category domain="http://www.blogger.com/atom/ns#">favorites</category>
<category domain="http://www.blogger.com/atom/ns#">skincare</category>
<title>A Random Girl's Best Of 2020: Skincare Edition</title>
<description><p style="text-align: center;"></p><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEinGpHvYz8PAgqamb8VR1Br3Xbm7lwPevAcP5WcpA5zQl1KR-yxVlR8fwcUgofoabCkGydCbatTQENaz5bqy65x5zR70V6whS4jpB3r6lqjw5N49Dq8kOqWZM5tXOtquxR3KTuAzq_vU4rU/s2048/img_9463.jpg" style="margin-left: 1em; margin-right: 1em;"><span style="font-size: large;"><img border="0" data-original-height="2048" data-original-width="1536" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEinGpHvYz8PAgqamb8VR1Br3Xbm7lwPevAcP5WcpA5zQl1KR-yxVlR8fwcUgofoabCkGydCbatTQENaz5bqy65x5zR70V6whS4jpB3r6lqjw5N49Dq8kOqWZM5tXOtquxR3KTuAzq_vU4rU/s16000/img_9463.jpg" /></span></a></div><span style="font-size: large;"><br /></span><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhf22Jjn6HDlqbK5bea7B3N9ztdpNtybqQBIct_yg7tZHh6jSmrvbFKdGedkieMasPR61YZ839_gpgfOY7InWGsQs0GjiYel3XjD97ksolGblKAnWF_m1a08-xHENlT3RXVwZHot-j5QV1h/s2048/img_9466.jpg" style="margin-left: 1em; margin-right: 1em;"><span style="font-size: large;"><img border="0" data-original-height="1536" data-original-width="2048" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhf22Jjn6HDlqbK5bea7B3N9ztdpNtybqQBIct_yg7tZHh6jSmrvbFKdGedkieMasPR61YZ839_gpgfOY7InWGsQs0GjiYel3XjD97ksolGblKAnWF_m1a08-xHENlT3RXVwZHot-j5QV1h/s16000/img_9466.jpg" /></span></a></div><p></p><p style="text-align: center;"><span style="font-size: large;"><br /></span></p><p style="text-align: center;"><span style="font-size: large;">I feel I've been away for so long I have to address it in some way, but I don't really feel like it, so let's move on to what skincare I've been using for this past year!</span></p><p style="text-align: center;"><span style="font-size: large;"><br /></span></p><p style="text-align: center;"><span style="font-size: large;">But first a little introduction to my skin (and me, in case you're new/forgot I exist): I'm Živa, I'm turning 30 next year and my skin has somehow gone from acne-prone to kinda sensitive and dry. But I feel like I'm getting way better at figuring out what works for me and my skin.</span></p><p style="text-align: center;"><span style="font-size: large;"><br /></span></p><h2 style="text-align: center;"><span style="font-size: x-large;">So here's a list of some tried-and-loved products!</span></h2><div><span style="font-size: x-large;"><br /></span></div><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/NIPFAB-Vitamin-C-Fix-Brightening-80-Pads?q=nip+%2B+fab+pads&amp;q_typ=f" target="_blank">NIP+FAB Vitamin C Fix Brightening Pads</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">Okay, seriously? These don't make a huge change to the <i>look </i>of my skin but they make it <b>feel plumper, fuller and softer</b>. Plus they smell like <b><i>oranges</i></b>. And I'm into it. AND it feels like they really prevent my skin from getting breakouts. NIP+FAB is a brand I discovered this year and I've been really loving it. I bought mine on FeelUnique and they're on sale right now!</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/Elemis-Soothing-Apricot-Toner-200ml?q=apricot+elemis&amp;q_typ=f" target="_blank">Elemis Soothing Apricot Toner</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">Another discovery from a friend's recommendation, this toner is<b> really calming and has a pleasant, inoffensive smell</b> that makes me feel really calm. It really soothes my skin and makes it feel less blushy (blush-prone. blush-easy??) Plus the vibe of the product totally gives me <b>luxury </b>vibes and it's a joy to use.</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/REN-Wake-Wonderful-Night-Time-Facial-40ml?q=ren+wake+wonderful&amp;q_typ=f" target="_blank">REN Wake Wonderful Night-Time Facial</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">I'm on my second bottle of this stuff. At first I bought it a bit begrudgingly because at the time, it was the only AHA product in the store I went to, but honestly, this stuff is amazing. I don't like how it feels on the skin which is why I don't use it enough (it's thick and a bit sticky) but OHMYGOD is it worth it. My skin feels <b>smoother </b>a day after using it.&nbsp;</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/Origins-Drink-Up-Intensive-Hydrating-Overnight-Mask-with-Avocado-and-Swiss-Glacier-Water-75ml?q=origins+overnight&amp;q_typ=f" target="_blank">Origins Drink Up Intensive Overnight Mask</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">I must've spoken about this before, right?! It's one of the best discoveries I made these past few years. This mask is intensely hydrating and very calming. It feels <b>pleasant </b>and it's actually <b>not annoying to sleep in</b>. I always apply it overnight when I need something <b>neutral and calming</b> for my skin.</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/NIPFAB-Dragons-Blood-Fix-Serum-Extreme-50ml?q=fix+extreme+nip+fab&amp;q_typ=f" target="_blank">NIP+FAB Dragon's Blood Fix Serum Extreme</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">I LOVE THIS STUFF. I don't know how, but it makes your skin plumped, really clear and perfectly colored. I used to get a lot of redness but using this really helped with irritated areas. I love this brand - I've tried 2 products and I adore both, so I can't wait to try more next year.</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h4 style="text-align: center;"><span style="font-size: large;"><a href="https://eu.feelunique.com/p/Kiehls-Creamy-Eye-Treatment-with-Avocado-14ml?q=kiehls+avocado&amp;q_typ=f" target="_blank">Kiehl's Creamy Eye Treatment with Avocado</a></span></h4><h4 style="text-align: center;"><br /></h4><p style="text-align: center;"><span style="font-size: medium;">I don't know if you saw my upcoming turning 30 confession at the beginning of this post (WHY GOD WHY?) but I figured it was time I started using eye cream. Sigh. So I bought this overhyped Kiehl's eye cream... And man, I'm part of the hype. This stuff is really <b>thick, smells lovely, makes my eyelids feel cooler and refreshed and even helps with hooding issues on the lids.&nbsp;</b></span></p><p style="text-align: center;"><span style="font-size: medium;"><b><br /></b></span></p><p style="text-align: center;"><span style="font-size: medium;">Those are the products I've been using in 2020 and will continue to use throughout next year.&nbsp;</span></p><p style="text-align: center;"><span style="font-size: medium;"><br /></span></p><h1 style="text-align: center;"><span style="font-size: x-large;">What was your top skincare product of 2020?</span></h1></description>
<link>http://nothinfancyreally.blogspot.com/2020/12/a-random-girls-best-of-2020-skincare.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEinGpHvYz8PAgqamb8VR1Br3Xbm7lwPevAcP5WcpA5zQl1KR-yxVlR8fwcUgofoabCkGydCbatTQENaz5bqy65x5zR70V6whS4jpB3r6lqjw5N49Dq8kOqWZM5tXOtquxR3KTuAzq_vU4rU/s72-c/img_9463.jpg" height="72" width="72"/>
<thr:total>0</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-6318979188525042445</guid>
<pubDate>Fri, 12 Jul 2019 16:58:00 +0000</pubDate>
<atom:updated>2019-07-14T13:38:08.169+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">books</category>
<category domain="http://www.blogger.com/atom/ns#">reading</category>
<title>Book review: Daisy Jones & The Six</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhZcLsSnV2iwZ0JAX3D_ltLI96YLPcZMPwVCR8-uXsazlBcfanXxGNmx0ZD543dC5pqyH3E-jlVJG70cWKHBUGoZsVFJlUbrvG5iUgAEdyl35wEWy9x3tYfXWaRNZoXOwsLZzC87mXtzZqD/s1600/daisy_jones_and_the_six_review_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1600" data-original-width="1200" height="640" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhZcLsSnV2iwZ0JAX3D_ltLI96YLPcZMPwVCR8-uXsazlBcfanXxGNmx0ZD543dC5pqyH3E-jlVJG70cWKHBUGoZsVFJlUbrvG5iUgAEdyl35wEWy9x3tYfXWaRNZoXOwsLZzC87mXtzZqD/s640/daisy_jones_and_the_six_review_2.jpg" width="480" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhPOowLsflgt3HEd-2YmmRROxX509Zc9b86LwZw3oL0YBoHYkAgvA2FAdtTvDxn6zp-JoxzfvW-3HG_tR-c0AA2-wMfJ50PFwqVHkx5up10sdTocMPbNuRrIRLBznBiaTfnOqHDtCzVBMdO/s1600/daisy_jones_and_the_six_review_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1600" data-original-width="1200" height="640" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhPOowLsflgt3HEd-2YmmRROxX509Zc9b86LwZw3oL0YBoHYkAgvA2FAdtTvDxn6zp-JoxzfvW-3HG_tR-c0AA2-wMfJ50PFwqVHkx5up10sdTocMPbNuRrIRLBznBiaTfnOqHDtCzVBMdO/s640/daisy_jones_and_the_six_review_3.jpg" width="480" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <h2 style="clear: both; text-align: center;"> Hi beautiful!</h2> <div> I've kind of gotten out of the habit of posting about books, but I recently read this beautiful story and I just had to share it with you guys! If you love heartbreaking love stories you will absolutely adore this one. It's worth it - try and give it a go.</div> <div> <br /></div> <div> Daisy Jones &amp; The Six is a story about the 70s - drugs, sex and rock'n'roll. All the characters in this book were seriously flawed which I really, really like. I've gotten a bit sick of too-perfect-to-be-real characters and I'm so excited more authors are exploring the darker side of their heroes.&nbsp;</div> <div> <br /></div> <div> <b>Here is the blurb for Daisy Jones &amp; The Six:</b></div> <blockquote class="tr_bq" style="text-align: center;"> <br /> Daisy is a girl coming of age in L.A. in the late sixties, sneaking into clubs on the Sunset Strip, sleeping with rock stars, and dreaming of singing at the Whisky a Go Go. The sex and drugs are thrilling, but it’s the rock ’n’ roll she loves most. By the time she’s twenty, her voice is getting noticed, and she has the kind of heedless beauty that makes people do crazy things.<br /> Also getting noticed is The Six, a band led by the brooding Billy Dunne. On the eve of their first tour, his girlfriend Camila finds out she’s pregnant, and with the pressure of impending fatherhood and fame, Billy goes a little wild on the road.<br /> Daisy and Billy cross paths when a producer realizes that the key to supercharged success is to put the two together. What happens next will become the stuff of legend.<br /> The making of that legend is chronicled in this riveting and unforgettable novel, written as an oral history of one of the biggest bands of the seventies. Taylor Jenkins Reid is a talented writer who takes her work to a new level with Daisy Jones &amp; The Six, brilliantly capturing a place and time in an utterly distinctive voice.</blockquote> <div style="text-align: left;"> For me, this was the standout novel of 2019 and I am so glad I finally picked it up. I'm currently reading the author's other novel, The Seven Husbands Of Evelyn Hugo, and also enjoying it a lot. My only criticism of this heartbreakingly beautiful book is that I wanted MORE! It ended up too abruptly for my liking and I just wanted more of the main characters. I'd love to know if you felt the same way in case you read this one.</div> <div style="text-align: center;"> <b><i>What's your favorite book of this summer?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2019/07/book-review-daisy-jones-six.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhZcLsSnV2iwZ0JAX3D_ltLI96YLPcZMPwVCR8-uXsazlBcfanXxGNmx0ZD543dC5pqyH3E-jlVJG70cWKHBUGoZsVFJlUbrvG5iUgAEdyl35wEWy9x3tYfXWaRNZoXOwsLZzC87mXtzZqD/s72-c/daisy_jones_and_the_six_review_2.jpg" height="72" width="72"/>
<thr:total>0</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-464767661941330658</guid>
<pubDate>Tue, 09 Jul 2019 13:07:00 +0000</pubDate>
<atom:updated>2019-07-11T13:32:42.679+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">catrice</category>
<category domain="http://www.blogger.com/atom/ns#">drugstore</category>
<category domain="http://www.blogger.com/atom/ns#">essence</category>
<category domain="http://www.blogger.com/atom/ns#">lipgloss</category>
<category domain="http://www.blogger.com/atom/ns#">makeup</category>
<category domain="http://www.blogger.com/atom/ns#">nyx</category>
<category domain="http://www.blogger.com/atom/ns#">rimmel</category>
<title>Best Drugstore Lipglosses 2019</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9gBjAI8PCT2j9scudWV_CawLJ3evAioIS5VrfQBa3cRxfHXcCOpxrv9T66S0bKWPYtjI1vJjJDksiVb3D1kcRJ-O4OqIgnGkBZ_n18afe30P3JgCrQx3RETTvc-qpUKiO-LdS0U5sCdMm/s1600/best_drugstore_lipglosses_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1600" data-original-width="1200" height="640" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9gBjAI8PCT2j9scudWV_CawLJ3evAioIS5VrfQBa3cRxfHXcCOpxrv9T66S0bKWPYtjI1vJjJDksiVb3D1kcRJ-O4OqIgnGkBZ_n18afe30P3JgCrQx3RETTvc-qpUKiO-LdS0U5sCdMm/s640/best_drugstore_lipglosses_1.jpg" width="480" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhoisLRgVmy_BAN_0xjLHmosb2o9TpxR8sfBA_2pgTBszzvIs6iQwKg4hJu-o7M8CyDmlbTY-xOdA0QlwfyswblzBffJ97Jpl88gViT-W-zSt_9-UbTZBrl6V-MQvVxhtoGUkVJSkS9lx5o/s1600/best_drugstore_lipglosses_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1200" data-original-width="1600" height="480" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhoisLRgVmy_BAN_0xjLHmosb2o9TpxR8sfBA_2pgTBszzvIs6iQwKg4hJu-o7M8CyDmlbTY-xOdA0QlwfyswblzBffJ97Jpl88gViT-W-zSt_9-UbTZBrl6V-MQvVxhtoGUkVJSkS9lx5o/s640/best_drugstore_lipglosses_3.jpg" width="640" /></a></div> <br /> <div style="text-align: center;"> <b><span style="font-size: large;">Hi beautiful!</span></b></div> <div style="text-align: center;"> <br /></div> <i>I've rediscovered my love for lipgloss in the past few months. I haven't worn it in years, I've been all about that lipstick life, but I think I've severely neglected my lipgloss addiction! Just because liquid lippies were all the rage doesn't mean I shouldn't ever wear lipgloss again - it's pretty and I love how juicy it makes my lips look. I've prepared a roundup of my drugstore favorites below!</i><br /> <i><br /></i> <br /> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Rimmel Oh My Gloss!</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> Everyone needs a red gloss in their life. It just gives a <b>sexy pop of color</b> and I love this shade of red - it's very <b>cool toned</b> which looks good on my skin. This gloss is a little bit sticky but I find it really doesn't bother me. The shade pictured here is <b>500 Ooh La La</b>. I received this product in PR but I am planning on purchasing a couple more colors. You can purchase this lipgloss <a href="https://www.notino.si/rimmel/oh-my-gloss-sijaj-za-ustnice/">here </a>for less than 5€.</div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Catrice Dewy-ful Lips</span></u></b></i></div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> This is such an amazing find! I picked it up by coincidence in my local drugstore and completely fell in love. It's<b> light, not sticky at all</b>, and actually feels like it's <b>conditioning </b>my lips, so a win all around. The shade I have is <b>060 Don't Dream It, DEW It</b>! I believe they have a couple of other shades which I will definitely be picking up. The <b>pigmentation isn't amazing</b> but I love it for the lip-balm feel - it doesn't dry out my lips at all. More information <a href="https://catrice.eu/lips/lipstick/lipsticks/catrice-cosmetics/dewy-ful-lips-conditioning-lip-butter.html">here</a>, and I believe the price was around 5€.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Catrice Prisma Lip Glaze</span></u></b></i></div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> These are SO beautiful in the tube, I would honestly just buy them to take pictures... But luckily they're very pretty as well! They're similar to the Essence Shine Shine Shine glosses in that they're a bit sticky, but beautiful all around. They also work great as <b>topcoats over a liquid lipstick</b>. I have the shade <b>050 Holy Moly</b>. More information on Catrice's website <a href="https://catrice.eu/en/lips/lip-gloss/lip-balm/catrice-cosmetics/prisma-lip-glaze-5.html">here</a>.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">NYX Butter Gloss</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> The shades I picked up are both quite neutral, and are called <b>Tiramisu </b>(the more brown one) and <b>Vanilla Cream Pie</b> (the pinker one). These glosses remind me a bit of the Dewy-ful lips as they're quite conditioning and very very pretty. They're an <b>easy, throw on shade</b> that you don't need to worry about, but need to <b>reapply </b>a bit more often. They're a little sticky, but nothing I can't handle. You can pick them up <a href="https://www.notino.si/nyx-professional-makeup/butter-gloss-sijaj-za-ustnice/">here </a>for 6,5€.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Essence Shine Shine Shine</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> The shades pictured above are <b>15 Watch Me Do</b> and <b>03 Friends of Glamour</b>. This lipgloss is that quintessential 90s <b>sticky glittery gloss</b>, so you might be asking yourself what the hell it's doing in this roundup... But I have to admit I have a soft spot for products like this. It <b>looks pretty, makes my lips appear bigger, and is the perfect product to just throw on when you're in a rush</b>. I believe the price is under 4€ as well, so it's a total bargain!</div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: left;"> That's it for this roundup! I would love to do another one in a couple of months for high-end lipglosses, but I honestly haven't picked any up yet because I just wanted to try out the drugstore offerings first. Now that I'm officially in love, it's time to try out more products!</div> <div style="text-align: center;"> <b><i>What's your favorite lipgloss?</i></b><br /> <b><i><br /></i></b> <b><i></i></b><br /> <a name='more'></a><b><i><br /></i></b><br /> <div style="text-align: center;"> <span style="font-size: large;"><b>Hej, lepotička!</b></span><br /> <span style="font-size: large;"><b><br /></b></span></div> <div style="text-align: start;"> <i>V zadnjih nekaj mesecih sem ponovno odkrila svojo ljubezen do glossov. Že leta nosim večinoma tekoče šminke, ampak to se je pred kratkim spremenilo! Čeprav obožujem tekoče šminke, sem že malo naveličana mat videza - včasih prav paše malo sijaja na ustnicah :) Zate sem pripravila povzem svojih najljubših izdelkov iz drogerije. Bonus: nobeden ne stane več kot 7€!</i></div> <div style="text-align: start;"> <i><br /></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Rimmel Oh My Gloss!</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> Se mi zdi, da prav vse potrebujemo en rdeč gloss v svojem življenju. Da ti zapeljivo barvo, tale odtenek je pa res čudovit - na mojo kožo bolj pašejo ti hladni toni. Je sicer malo lepljiv, ampak mene ne moti. Odtenek na sliki je&nbsp;<b>500 Ooh La La</b>. Se mi zdi, da ga rabim še v nekaj barvah. Kupiš ga lahko&nbsp;<a href="https://www.notino.si/rimmel/oh-my-gloss-sijaj-za-ustnice/">tule</a>&nbsp;za manj kot 5€.</div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Catrice Dewy-ful Lips</span></u></b></i></div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> Tole je bilo pa res odkritje leta! Kupila sem ga čisto po slučaju, in se čisto zaljubila! Lahek, prav nič lepljiv izdelek, pa še občutek daje, da ustnice neguje. Moj odtenek je&nbsp;<b>060 Don't Dream It, DEW It</b>! Imajo še nekaj odtenkov, ki sem jih že dodala na svoj seznam. Najboljša stvar je pa, da ustnic niti malo ne izsuši. Več informacij najdeš&nbsp;<a href="https://catrice.eu/lips/lipstick/lipsticks/catrice-cosmetics/dewy-ful-lips-conditioning-lip-butter.html">tukaj</a>.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Catrice Prisma Lip Glaze</span></u></b></i></div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> Tale gloss je pa tako lep, da bi ga kupila samo za fotke... K sreči je pa tudi super izdelek! Malo so podobni Essence Shine Shine Shine glossom, ker so rahlo lepljivi, ampak se splača! Meni so najboljši kot dodaten nanos čez šminko, saj dajo čudovit sijaj.&nbsp;Moj odtenek je&nbsp;<b>050 Holy Moly</b>. Več informacij najdeš na spletni strani Catrice&nbsp;<a href="https://catrice.eu/en/lips/lip-gloss/lip-balm/catrice-cosmetics/prisma-lip-glaze-5.html">tukaj</a>.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">NYX Butter Gloss</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> Oba odtenka, ki sem ju kupila, sta precej nevtralna. Barvi sta&nbsp;<b>Tiramisu&nbsp;</b>(bolj rjav ton) in&nbsp;<b>Vanilla Cream Pie</b>&nbsp;(bolj roza ton). Teli izdelki me spominjajo na Dewy-ful lips saj so zelo lepi na ustnicah, obenem pa tudi negujejo. Prav z lahkoto se nanesejo, moraš pa večkrat ponoviti aplikacijo.&nbsp;Majčkeno lepljivi, ampak nič groznega. Kupiš jih lahko&nbsp;&nbsp;<a href="https://www.notino.si/nyx-professional-makeup/butter-gloss-sijaj-za-ustnice/">tukaj</a>&nbsp;za&nbsp;6,5€.</div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;">Essence Shine Shine Shine</span></u></b></i></div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: center;"> Odtenka na sliki sta&nbsp;<b>15 Watch Me Do</b>&nbsp;in&nbsp;<b>03 Friends of Glamour</b>. Tale lipgloss ima prav tisto formula iz leta 2000... Saj veš, ko smo vse uporabljale&nbsp;<b>lepljive, bleščičaste glosse</b>. Mogoče se sprašuješ, kaj sploh počne v tej objavi... Ampak moram priznati, da še vedno obožujem takšne izdelke. Zgleda res lepo, super je, ko se ti kam mudi, ker se ni treba obremenjevati s svinčnikom, šminko, pa še čem... Stane pa manj kot 4€, tako da je za povrh vsega super ugoden!</div> <div style="text-align: center;"> <i><b><u><span style="font-size: large;"><br /></span></u></b></i></div> <div style="text-align: left;"> To je vse! Z veseljem bi pripravila še eno objavo o malo dražjih izdelkih, ampak trenutno sem se osredotočila na drogerijsko ponudbo, da sem se prepričala, če so mi glossi sploh še všeč. Zdaj pa, ko sem uradno zaljubljena vanje, me čaka še kakšen nakup malo dražjih znamk... Me prav zanima razlika!</div> <div style="text-align: center;"> <b><i>Kateri je tvoj najljubši lip gloss?</i></b></div> </div> <div style="text-align: center;"> <br /></div> <div style="text-align: center;"> <br /></div> </description>
<link>http://nothinfancyreally.blogspot.com/2019/07/best-drugstore-lipglosses-2019.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9gBjAI8PCT2j9scudWV_CawLJ3evAioIS5VrfQBa3cRxfHXcCOpxrv9T66S0bKWPYtjI1vJjJDksiVb3D1kcRJ-O4OqIgnGkBZ_n18afe30P3JgCrQx3RETTvc-qpUKiO-LdS0U5sCdMm/s72-c/best_drugstore_lipglosses_1.jpg" height="72" width="72"/>
<thr:total>0</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-676191424234867195</guid>
<pubDate>Sat, 22 Jun 2019 11:04:00 +0000</pubDate>
<atom:updated>2019-07-11T13:21:32.181+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">budget</category>
<category domain="http://www.blogger.com/atom/ns#">fragrance</category>
<category domain="http://www.blogger.com/atom/ns#">Notino</category>
<title>Best perfumes for summer 2019</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhsBigIYZmhQ1kicziOjuHHMaiHxIxbOTtMnSdfZ9QkHH_zMROsd_5zaJXsnZRPhUbHJvBfongA0xknzySawviDLNNX6e_v8a5MIhUPiNp7TrQJ1orCLLE1qse3P4Gw1dCwdu-VpKuMC9CB/s1600/best_summer_2019_perfumes_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1600" data-original-width="1200" height="640" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhsBigIYZmhQ1kicziOjuHHMaiHxIxbOTtMnSdfZ9QkHH_zMROsd_5zaJXsnZRPhUbHJvBfongA0xknzySawviDLNNX6e_v8a5MIhUPiNp7TrQJ1orCLLE1qse3P4Gw1dCwdu-VpKuMC9CB/s640/best_summer_2019_perfumes_1.jpg" width="480" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg7U_zun9pHHZgtsIyofXJ-tdphMQFwLgHWWHMVW1Ag4SwyQ7d_wQeUjjfbWKTnu2n-42QJd6RMCVtdXOhnsI72q3o6xOkkN6bWcnbghhVb6P3ht0apFhAd74xMVMOlD1EK8CXofIaKq3Qo/s1600/best_summer_2019_perfumes_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="1200" data-original-width="1600" height="480" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg7U_zun9pHHZgtsIyofXJ-tdphMQFwLgHWWHMVW1Ag4SwyQ7d_wQeUjjfbWKTnu2n-42QJd6RMCVtdXOhnsI72q3o6xOkkN6bWcnbghhVb6P3ht0apFhAd74xMVMOlD1EK8CXofIaKq3Qo/s640/best_summer_2019_perfumes_3.jpg" width="640" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <span style="font-size: large;"><b>Hi beautiful!</b></span></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> <i>It's been a hot minute since I've last posted, but I think the blogging bug has hit me again because I recently spent a weekend taking photos for new posts and imagining all the things I want to do with this space. I can't promise I'm back officially, but I will try to post more often and show you more of the things I've been loving. I think back in 2017 blogging became a chore for me, and I'm trying very very hard to make it fun for me again.</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>I adore perfume and I've always loved posting about my yummy favorites, so I thought it would be the perfect way to come back and share some of my summer favorites! Without further ado, let's just get into the scents that have been making my summer amazing...</i></div> <div class="separator" style="clear: both; text-align: center;"> <span style="font-size: large;"><br /></span></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://www.notino.si/jennifer-lopez/glow-by-jlo-toaletna-voda-za-zenske/"><span style="font-size: large;"><b><i>Glow by JLo EDT</i></b></span></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> This is, hands down, the perfume I think everybody needs. If you just want to smell <b>fresh, soapy, and like you came right out of the shower</b>, you've found the perfect perfume. It always makes me feel so fresh and ready to start my day, and I love <b>layering</b> it with other scents as well (it works so well with floral perfumes). Plus, it's an absolute <b>bargain</b>. Trust me, you'll be glad you got this one! It's less than 30€ for the big bottle.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/dolce-gabbana/light-blue-eau-intense-parfumska-voda-za-zenske/">Dolce &amp; Gabbana Light Blue Eau Intense</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Take a stroll in Ljubljana during the summer and you're guaranteed to smell Light Blue at least three times. I always liked the <b>sharp, citrusy scent</b> of this perfume but I hate smelling like everybody else, which is why I decided to pick up this intense version of the scent. It's even better in my opinion! Just like Glow, it makes you feel fresh, with the added bonus of that <b>sexy, expensive citrus</b>. A staple in my summer fragrance wardrobe for sure. The price ranges from 45€ for a small bottle but it's so worth it.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/armani/acqua-di-gioia-parfumska-voda-za-zenske/">Armani Acqua di Gioia EDP</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> I think this one has had a makeover, but I still have last year's bottle (the new one looks so sophisticated!) I always say this perfume is my <b>secret weapon</b> - and my <b>signature scent</b>. It's just such a <b>yummy, sexy watermelon scent</b> that just makes your mouth water and it's the perfect pick for summer! I also love the flankers that came out last year, but when I was trying them out, I always came back to this one - it's just soooo perfect!! Prices range from 39€+.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/roberto-cavalli/roberto-cavalli-parfumska-voda-za-zenske/">Roberto Cavalli Roberto Cavalli EDP</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> This is another one of those secret weapons I love, and I love wearing it for date night. It's sweet, sexy and beachy and I just adore it - plus the sillage is great and it lasts for ages. This one's definitely a compliment getter because people will smell it on you, and love it. I also love it for vacations, so if you're jetting off someplace nice: 1. I'm jealous 2. give this one a go at the Duty Free. I paid around 40€ for the biggest bottle on Notino which is just perfect as well.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I hope you enjoyed my foray into the best summer scents for this year! I'm sure I'll have another post like this coming soon - you know me, I'm just a perfume addict... and I could help it, but I don't want to!</div> <div class="separator" style="clear: both; text-align: center;"> <b><i>What is your favorite perfume for the hot summer months?</i></b></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><br /></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <b><i></i></b></div> <a name='more'></a><b><i><br /></i></b><br /> <div class="separator" style="clear: both; text-align: center;"> <b><span style="font-size: large;">Hej, lepotička!</span></b></div> <div class="separator" style="clear: both; text-align: center;"> <b><span style="font-size: large;"><i><br /></i></span></b></div> <div class="separator" style="clear: both; text-align: left;"> <i>Vem, da že dolgo nisem objavila ničesar, ampak pred nekaj tedni me je očitno spet pičila blogerska muha, saj sem cel vikend pripravljala fotke za nove objave. Ne morem obljubiti, da sem uradno nazaj, bom pa poskušala objavljati večkrat in ti pokazati več stvari, ki me trenutno navdušujejo. Mislim, da sem leta 2017 postala preobremenjena s službo, bloganje je postalo naloga in veselje do pisanja je izginilo.</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>Obožujem parfume, še raje pa pišem o njih. Danes s tabo delim nekaj svojih poletnih favoritov. Pa poglejmo, kaj se te mesece znajde na moji polici s parfumi...</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://www.notino.si/jennifer-lopez/glow-by-jlo-toaletna-voda-za-zenske/"><span style="font-size: large;"><b><i>Glow by JLo EDT</i></b></span></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Po mojem mnenju dišava, ki jo potrebuješ v svoji zbirki. Če želiš dišati&nbsp;<b>sveže, milnato, in kot da si ravnokar izpod tuša</b>, si našla popoln parfum. Z njim se vedno počutim sveže, pripravi me na nov dan, obenem pa je super tudi za&nbsp;<b>kombiniranje z drugimi vonji</b>&nbsp;(krasno gre skupaj s cvetličnimi parfumi). Poleg tega je pa še&nbsp;<b>zelo ugoden</b>. Verjemi mi, tale je res super! Stane pa manj kot 30€ za 100 ml.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/dolce-gabbana/light-blue-eau-intense-parfumska-voda-za-zenske/">Dolce &amp; Gabbana Light Blue Eau Intense</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Če se poleti sprehodiš po Ljubljani, grem stavit, da boš vsaj trikrat zavohala slavni Light Blue. Meni je bil vedno všeč njegov&nbsp;<b>oster, citrusen vonj</b>&nbsp;ampak ne maram dišati kot vsi ostali, zato sem zase raje izbrala tole intense verzijo. Po mojem mnenju je še boljša! Tako kot Glow je Light Blue Eau Intense zelo svež vonj, obenem pa ima še prednost&nbsp;<b>seksi svežega citrusa</b>. Definitivno nujen del moje poletne zbirke. Cene se gibajo od 45€ za manjšo stekleničko, in jaz mislim, da je parfum vreden vsakega evra!</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/armani/acqua-di-gioia-parfumska-voda-za-zenske/">Armani Acqua di Gioia EDP</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Mislim, da je tale parfum imel pred kratkim makeover, jaz imam pa še vedno staro stekleničko, čeprav se bližam koncu. Je pa nova verzija čudovita! Vedno pravim, da je tale vonj moje&nbsp;<b>skrivno orožje</b>&nbsp;- in pa tudi moj&nbsp;<b>signature vonj</b>. Res je&nbsp;<b>slasten, zapeljiv vonj po lubenici</b>, popoln za poletje in super svež! Všeč so mi tudi verzije, ki so izšle lani (Sun, Air di Gioia), ampak se kar naprej vračam k temu - prav popoln je! To je že moja druga 100 ml steklenička, pa sem spet čisto pri koncu... Cene gredo pa od 39€ naprej.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i><span style="font-size: large;"><a href="https://www.notino.si/roberto-cavalli/roberto-cavalli-parfumska-voda-za-zenske/">Roberto Cavalli Roberto Cavalli EDP</a></span></i></b></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> Še eno od tistih skrivnih orožij, ki jih obožujem. Tale je popoln za date night. Sladek, zapeljiv in primeren za vroče dneve - pa še dolgo se obdrži, in garantirano ga bodo zavohali ljudje okrog tebe. Tale parfum dobiva komplimente vsakič, ko ga uporabim. Meni je najbolj všeč za na počitnice, tako da, če se kam odpravljaš: 1. sem ljubosumna nate 2. preizkusi tale vonj v Duty Free. Jaz sem plačala okrog 40€ na Notinu.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> Upam, da ti je objava o poletnih parfumih pomagala! Prav gotovo bo sledila še kakšna, saj veš, malo sem obsedena s parfumi...&nbsp;</div> <div class="separator" style="clear: both;"> </div> <div class="separator" style="clear: both; text-align: center;"> <b><i>Kateri je tvoj najljubši poletni parfum?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2019/06/best-perfumes-for-summer-2019.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhsBigIYZmhQ1kicziOjuHHMaiHxIxbOTtMnSdfZ9QkHH_zMROsd_5zaJXsnZRPhUbHJvBfongA0xknzySawviDLNNX6e_v8a5MIhUPiNp7TrQJ1orCLLE1qse3P4Gw1dCwdu-VpKuMC9CB/s72-c/best_summer_2019_perfumes_1.jpg" height="72" width="72"/>
<thr:total>0</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-954622832433705383</guid>
<pubDate>Tue, 18 Jul 2017 11:02:00 +0000</pubDate>
<atom:updated>2017-07-18T13:02:54.620+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">acne</category>
<category domain="http://www.blogger.com/atom/ns#">clinique</category>
<category domain="http://www.blogger.com/atom/ns#">high end</category>
<category domain="http://www.blogger.com/atom/ns#">la roche posay</category>
<category domain="http://www.blogger.com/atom/ns#">origins</category>
<category domain="http://www.blogger.com/atom/ns#">skincare</category>
<category domain="http://www.blogger.com/atom/ns#">sunday riley</category>
<title>Current Skincare Favorites</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi2Jh40bNeRdfGRzC1QzPkdDi2UWl8XZdeY-RWo2HYMB7XzA7catGCk0AzHS4dX-k0OXiMdgvYhir5XpU0F0DHZib0Bg8-UVP68OsnUwOO_DzBqGUmCR9fi9QeKfYn8qeW80xsAojPyKrHO/s1600/IMG_0649.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="900" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi2Jh40bNeRdfGRzC1QzPkdDi2UWl8XZdeY-RWo2HYMB7XzA7catGCk0AzHS4dX-k0OXiMdgvYhir5XpU0F0DHZib0Bg8-UVP68OsnUwOO_DzBqGUmCR9fi9QeKfYn8qeW80xsAojPyKrHO/s1600/IMG_0649.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgNMfQqEJmz2BDnDCz0WNVmCPjY9cB0RuX8IxPaQkzCgIijc-I8A-NEWIpItujlPfuXQI1mX868ryBuI3NSV924fMlsg9OjLvABAZ1SUTTjP2zo0_CYmhR_8WJhSAgfdZKwk7dZz_zQpfAE/s1600/IMG_0653.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="400" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgNMfQqEJmz2BDnDCz0WNVmCPjY9cB0RuX8IxPaQkzCgIijc-I8A-NEWIpItujlPfuXQI1mX868ryBuI3NSV924fMlsg9OjLvABAZ1SUTTjP2zo0_CYmhR_8WJhSAgfdZKwk7dZz_zQpfAE/s1600/IMG_0653.JPG" /></a></div> <div class="separator" style="clear: both; text-align: center;"> </div> <h2 style="text-align: center;"> Hello my lovelies!</h2> <br /> <div class="separator" style="clear: both; text-align: left;"> <i>It's been a long time since you've seen me post around here, but that's hopefully going to change in the coming weeks. I had to take a little work-related break, but I'm back with so many new beauty goodies and so many things I want to talk about. I can't wait to tell you what I've been up to.</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>Today I wanted to do a post on skincare that has been working for me lately, and might hopefully help you out a little too. I also wanted to add I've been slowly transitioning from a mostly drugstore regimen to something a bit more high end. I feel like I'm a bit older now and I can finally afford to spend a bit more on my beauty regimen, so why not?</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>I'm still struggling with problematic skin which is honestly so annoying. It should be over once you turn twenty-five, but it seems like it's worse than it has been in a while. But these products really help my skin, and when I use them religiously, my complexion looks so much better.</i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i>So let's just get started with the products I've been loving lately!</i></div> <!-- COLLECTIVE WIDGET CODE START --> <div class="shopsense-widget" style="text-align:center" data-options="%7B%22widgetId%22%3A%22596de14cdd4edb3a166ce176%22%2C%22version%22%3A1%2C%22pid%22%3A%22uid4004-30511498-73%22%2C%22size%22%3A120%2C%22columns%22%3A5%2C%22rows%22%3A1%2C%22url%22%3A%22https%3A%2F%2Fapi.shopstyle.com%2Fapi%2Fv2%22%2C%22iframeHeight%22%3A195%2C%22iframeWidth%22%3A735%7D"> <script> !function(doc,s,id){ var e, p, cb; if(!doc.getElementById(id)) { e = doc.createElement(s); e.id = id; cb = new Date().getTime().toString(); p = '//shopsensewidget.shopstyle.com/widget-script.js?cb=1500375679470?cb=' + cb; e.src = p; doc.body.appendChild(e); } if(typeof window.ss_shopsense === 'object'){ if(doc.readyState === 'complete'){ window.ss_shopsense.init(); } } }(document, 'script', 'shopsensewidget-script'); </script> <iframe src="//shopsensewidget.shopstyle.com/#/?options=%7B%22widgetId%22%3A%22596de14cdd4edb3a166ce176%22%2C%22version%22%3A1%2C%22pid%22%3A%22uid4004-30511498-73%22%2C%22size%22%3A120%2C%22columns%22%3A5%2C%22rows%22%3A1%2C%22url%22%3A%22https%3A%2F%2Fapi.shopstyle.com%2Fapi%2Fv2%22%2C%22iframeHeight%22%3A195%2C%22iframeWidth%22%3A735%7D" height="195px" width="735px" seamless style="border: 0;"> </iframe> </div> <!-- COLLECTIVE WIDGET CODE END --> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <div class="separator" style="clear: both; text-align: left;"> <i><br /></i></div> <h4 style="clear: both; text-align: center;"> Origins GinZing Eye Cream</h4> <div class="separator" style="clear: both; text-align: left;"> I remember years and years ago, when I used to be obsessed with Origins but there was just no way for me to get it. Fast forward to today and this cream is one of my favorite products. YAY! I finally got my hands on it. It's scented slightly like <b>sunscreen </b>and it feels so pleasant and <b>cooling </b>on my eyes. I've been struggling with <b>itchy/dry</b> undereyes and this has really been helping a lot. I got it from <a href="http://eu.feelunique.com/p/Origins-GinZing-Refreshing-Eye-Cream-to-Brighten-and-Depuff-15ml">FeelUnique </a>for around 22€.</div> <h4 style="clear: both; text-align: center;"> Sunday Riley Good Genes</h4> <div class="separator" style="clear: both; text-align: left;"> You know all the good stuff people say about this product? Well, it's all true. I ADORE it. It's just one of those moisturizers that <b>makes a difference overnight</b>, and I can always count on it to make my skin beautiful by the time I wake up. I seriously love it. Good Genes is a <b>lactic acid treatment </b>and it honestly rejuvenates and refreshes my skin in a matter of hours. Whether it be breakouts, dryness or itchiness, it takes care of it all. SO worth the price, although repurchasing it might make my wallet cry. I got it from <a href="https://www.net-a-porter.com/si/en/product/459656/sunday_riley/good-genes-treatment--30ml">NAP </a>for around 100€.</div> <h4 style="clear: both; text-align: center;"> Sunday Riley UFO Oil</h4> <div class="separator" style="clear: both; text-align: left;"> This is a newer addition to my skincare routine and I've only been using a couple of times per week, but I feel like it moisturizes my skin like nothing else. I've discovered my skin is really <b>dehydrated </b>despite being so oily (or maybe because of it?) and this product makes it look <b>plump </b>and refreshed, which I just love. I haven't tried any of the other Sunday Riley oils, and I do have to say, the <b>tint </b>they put in them really puts me off. I seriously look like a Martian with this on... But it helps me break out less, and around that time of the month, it's a lifesaver. You can get it <a href="https://www.net-a-porter.com/si/en/product/844664?resType=single&amp;keywords=ufo&amp;termUsed=ufo&amp;enableAjaxRequest=false">here </a>for around 90€.</div> <h4 style="clear: both; text-align: center;"> La Roche Posay Effaclar Micellar Water</h4> <div class="separator" style="clear: both; text-align: left;"> I love this brand and I love their Effaclar range, so this micellar water is another win for me. I love the <b>big packaging</b>, it's <b>gentle </b>but efficient, and <b>inexpensive</b>. I don't think I've used a LRP product I didn't love (except for Duo&nbsp;+, but I need to try that again). I would really recommend this. You can get it <a href="http://www.feelunique.com/p/La-Roche-Posay-Effaclar-Ultra-Purifying-Micellar-Water-400ml">here </a>or in your local pharmacy for around 12€.</div> <h4 style="text-align: center;"> Clinique Anti-Blemish Solutions Clininal Clearing Gel</h4> <div style="text-align: left;"> Okay, this might be a bit controversial. It's heavily <b>alcoholic </b>and you can smell it, but the thing is, it works so well. <b>It dries out my breakouts without irritating my skin in a matter of hours</b>, maybe one or two. It helps so much when I have a problematic area, and I can't imagine not using it. Similar to Grease Lightning by Lush but SO much faster. I love it. It's pricy as far as I can remember, around 40€, but I love it.</div> <h4 style="text-align: center;"> Clinique Anti-Blemish Solutions Blemish&nbsp;+ Line Correcting Serum</h4> <div style="text-align: left;"> I've really been enjoying this product as well. It's not as alcoholic and <b>feels pleasant and hydrating on the skin but still like it's actually doing something</b>. This was pricy as well (I feel like it cost about 55€, can't remember), and while I probably won't repurchase it, I've been really enjoying it.</div> <div style="text-align: left;"> <br /></div> <div style="text-align: center;"> These items have been helping my skin a lot, and I've really been loving adding them to my skincare routine!</div> <div style="text-align: center;"> <b><i>What's your favorite skincare product at the moment?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2017/07/current-skincare-favorites.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi2Jh40bNeRdfGRzC1QzPkdDi2UWl8XZdeY-RWo2HYMB7XzA7catGCk0AzHS4dX-k0OXiMdgvYhir5XpU0F0DHZib0Bg8-UVP68OsnUwOO_DzBqGUmCR9fi9QeKfYn8qeW80xsAojPyKrHO/s72-c/IMG_0649.JPG" height="72" width="72"/>
<thr:total>2</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-3721398627703242679</guid>
<pubDate>Thu, 15 Jun 2017 11:56:00 +0000</pubDate>
<atom:updated>2017-06-15T13:56:50.319+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">blogging</category>
<category domain="http://www.blogger.com/atom/ns#">personal</category>
<category domain="http://www.blogger.com/atom/ns#">random</category>
<title>Why it's okay to take a break sometimes</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgELGJxxM-fvfzd4xIshWRX6Xk5sh7aSMrEX4vapCrXvZQyjDRKQfNR5qsYlLaBIxZHVgwEUkHMERzYo6Qm0wusi85wZiHiQV-kcZgHEE83SexstPlBpS5YHXBBdQBLVGQfAjQSWTY4R8EQ/s1600/break1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="900" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgELGJxxM-fvfzd4xIshWRX6Xk5sh7aSMrEX4vapCrXvZQyjDRKQfNR5qsYlLaBIxZHVgwEUkHMERzYo6Qm0wusi85wZiHiQV-kcZgHEE83SexstPlBpS5YHXBBdQBLVGQfAjQSWTY4R8EQ/s1600/break1.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiJcfUlTkQ9CdBkA4Ig7bjLtdyZe7MESLLqBeJUdGYJ4FL-rhwxaaNS7ugYJA3drDNs4N9xKZ7XFEM1lEtS3g1KAwsCGBJ9zIyma9yTJkkGDvfK9dGZP5TTuXKmfcpNXja7lcxsxcBubvtY/s1600/break2.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="400" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiJcfUlTkQ9CdBkA4Ig7bjLtdyZe7MESLLqBeJUdGYJ4FL-rhwxaaNS7ugYJA3drDNs4N9xKZ7XFEM1lEtS3g1KAwsCGBJ9zIyma9yTJkkGDvfK9dGZP5TTuXKmfcpNXja7lcxsxcBubvtY/s1600/break2.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj4Jo_zeRP6neOvrNZV-uw5z2EuOnNea3DshpbBMTKmnzEIxPJbhtGVoUTwJTJ0S06NhyHLv-cuDY0YD2hWrA5ecOfOPUZfNFx5WqEUgTCrqB6O4FSWlzZyOIpHmKAgQQpJKbKtnqxrOyF1/s1600/break3.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="400" data-original-width="600" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj4Jo_zeRP6neOvrNZV-uw5z2EuOnNea3DshpbBMTKmnzEIxPJbhtGVoUTwJTJ0S06NhyHLv-cuDY0YD2hWrA5ecOfOPUZfNFx5WqEUgTCrqB6O4FSWlzZyOIpHmKAgQQpJKbKtnqxrOyF1/s1600/break3.JPG" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> </div> <ol> <li>So you can stop and smell the roses</li> <li>For the scent of fresh coffee in the morning, and a to-do list that makes you feel excited you're alive</li> <li>To feel your fingers brush your pet's fur, and see them lean against your hand</li> <li>So you can focus on your career and achieve acomplishments you were too scared to even dream of</li> <li>Because you know you will break if you don't</li> <li>Knowing that the right people, the best people, will wait for you while you put yourself back together</li> <li>So you can come back with your senses renewed, full of enthusiasm and excitement for the projects that lay ahead</li> <li>Because a break will clear your mind, and renew all those ideas you've been too afraid to make a reality</li> <li>Your dreams will become projects, and your projects will become dreams</li> <li>And you will make everything you've worked for become a reality, you will be the best version of you you've ever been, and you will be ready for this new chapter of your life.</li> </ol> <br /><div> <b>I hope you'll crack open a new spine, and enter this new story. I'll hold your hand.</b></div> <div> <b>Welcome back, Nothin' Fancy. Really.</b></div> <br /> <br /></description>
<link>http://nothinfancyreally.blogspot.com/2017/06/why-its-okay-to-take-break-sometimes.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgELGJxxM-fvfzd4xIshWRX6Xk5sh7aSMrEX4vapCrXvZQyjDRKQfNR5qsYlLaBIxZHVgwEUkHMERzYo6Qm0wusi85wZiHiQV-kcZgHEE83SexstPlBpS5YHXBBdQBLVGQfAjQSWTY4R8EQ/s72-c/break1.JPG" height="72" width="72"/>
<thr:total>2</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-7243227735351131128</guid>
<pubDate>Thu, 19 Jan 2017 11:18:00 +0000</pubDate>
<atom:updated>2017-01-19T12:18:23.726+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">cartier</category>
<category domain="http://www.blogger.com/atom/ns#">chanel</category>
<category domain="http://www.blogger.com/atom/ns#">drugstore</category>
<category domain="http://www.blogger.com/atom/ns#">fragrance</category>
<category domain="http://www.blogger.com/atom/ns#">high end</category>
<category domain="http://www.blogger.com/atom/ns#">perfume</category>
<category domain="http://www.blogger.com/atom/ns#">terry de gunzburg</category>
<category domain="http://www.blogger.com/atom/ns#">the body shop</category>
<category domain="http://www.blogger.com/atom/ns#">winter</category>
<title>Current Favorite Winter Scents</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjDhMsqpVyYKjpuHR6X9mTfQN32wGP0x08p3SIqH2QeGxmbn4AJzYvIjjh2kB6vaqoHHchdOfeND77snTspdft2BXBMqX5_Z8QpY-CoZquejr_yNvDbD3hutJze70S0540bK8o-nkugBPZ9/s1600/current_favorite_winter_perfumes_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjDhMsqpVyYKjpuHR6X9mTfQN32wGP0x08p3SIqH2QeGxmbn4AJzYvIjjh2kB6vaqoHHchdOfeND77snTspdft2BXBMqX5_Z8QpY-CoZquejr_yNvDbD3hutJze70S0540bK8o-nkugBPZ9/s1600/current_favorite_winter_perfumes_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjrAwhlzm-Oq2aORgEAYrVCpaVx4GETvVSAvBkdBoSLk8Cfv_D6cUzAF8-YowrJrtpw6LKMjx1MyKMAQaI6k4urJ7273Ui-4Pwq-jlKPVx8tke_glNuxdecQXzqURvnS-FPMKEQ72L7BExZ/s1600/current_favorite_winter_perfumes_2.png" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjrAwhlzm-Oq2aORgEAYrVCpaVx4GETvVSAvBkdBoSLk8Cfv_D6cUzAF8-YowrJrtpw6LKMjx1MyKMAQaI6k4urJ7273Ui-4Pwq-jlKPVx8tke_glNuxdecQXzqURvnS-FPMKEQ72L7BExZ/s1600/current_favorite_winter_perfumes_2.png" /></a></div> <h2 style="text-align: center;"> You know I'm a huge fragrance addict...&nbsp;</h2> <div> I purchased a few new scents and discovered some old favorites this winter season, and I wanted to do a little roundup of fragrances that have made my list of favorites lately. Let's see...</div> <h3 style="text-align: center;"> Cartier Goutte de Rose EDT</h3> <div> A beautiful <b>sweet rose</b> fragrance I've falled head over heels in love with. I've been wearing this all the time for a year now, so much so it's almost becoming my signature scent. It has good lasting power, moderate sillage and suits me perfectly. It's not the old lady rose I'm used to, it's <b>fresher </b>and sweeter. Beautiful, and I'd highly recommed sampling this beauty - I know it wouldn't be my first pick from the Cartier counter, but I'm so glad I gave it a go! It has rose, woodsy notes, vanilla and amber mixed in the juice.</div> <h3 style="text-align: center;"> The Body Shop Vineyard Peach Body Mist</h3> <div> Bit of a random find, but if you like layering your fragrances, adding a <b>peach </b>note from this body spray will work so well! I adore this, it's <b>weak </b>but has good sillage so you have to <b>reapply it often</b>. But the scent... It's the <b>freshest, juiciest peach</b> ever, a note I've been struggling to find in my perfumes and can only get from this particular body mist. I just love it! And a bonus - I picked it up for 3.50 pounds in TBS' annual sale.</div> <h3 style="text-align: center;"> Chanel Coco Mademoiselle EDP</h3> <div> A recent purchase I've grown to love. Initially I wasn't a fan of this scent, but I feel like it suits me well now that I'm in my (gasp) mid-twenties. It's a very <b>pretty white floral with a lot of citrus, vanilla and rose</b>. I wish it didn't have the <b>patchouli </b>note, but I've learned to live with it. Average sillage and lasting power. Perfect for a more ladylike scent, if you've grown out your sweet and fruity perfumes, this is one to try.</div> <h3 style="text-align: center;"> Terry De Gunzburg Rêve Opulent</h3> <div> I've been wanting a Terry fragrance for ages now, and I managed to sample them all when I was in London.&nbsp;Rêve Opulent is the definite winner for me. <b>Citrus, vanilla and white florals - sweet, fresh and a little bit sexy</b>. I just adore it, though I do <b>wish it had better lasting power</b>, my skin seems to just drink it up. Otherwise it would be a firm favorite because that scent is just stunning. Would work perfectly in the warmer months.</div> <div> <br /></div> <div> I'd love to know if you have any of these scents or if any of them catch your fancy. My favorite scent right now is definitely the Terry one, it's just so perfect for me.</div> <div style="text-align: center;"> <b><i>What fragrance are you wearing today?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2017/01/current-favorite-winter-scents.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjDhMsqpVyYKjpuHR6X9mTfQN32wGP0x08p3SIqH2QeGxmbn4AJzYvIjjh2kB6vaqoHHchdOfeND77snTspdft2BXBMqX5_Z8QpY-CoZquejr_yNvDbD3hutJze70S0540bK8o-nkugBPZ9/s72-c/current_favorite_winter_perfumes_1.jpg" height="72" width="72"/>
<thr:total>4</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-351562167870013856</guid>
<pubDate>Mon, 02 Jan 2017 14:23:00 +0000</pubDate>
<atom:updated>2017-01-02T15:23:53.571+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">candle</category>
<category domain="http://www.blogger.com/atom/ns#">home decor</category>
<category domain="http://www.blogger.com/atom/ns#">yankee candle</category>
<title>January 2017 Yankee Candle Haul</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3JYb1CcBkyCEkszpBZ-t1-YcL7p3l7_AYbzydEKMAFxjJDqoo8CjVKsPC8C5LY8IwWkgrh6UUmns-7nondZwr9zKBGp9yTh7lvB6LnpVlBXVyBRC8LfKK3ryiRsrDW8_OABYwZjSI5C5R/s1600/january_2017_yankee_candle_haul_1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3JYb1CcBkyCEkszpBZ-t1-YcL7p3l7_AYbzydEKMAFxjJDqoo8CjVKsPC8C5LY8IwWkgrh6UUmns-7nondZwr9zKBGp9yTh7lvB6LnpVlBXVyBRC8LfKK3ryiRsrDW8_OABYwZjSI5C5R/s1600/january_2017_yankee_candle_haul_1.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9eX1HJ-Jjl4Um2vCLtbDJIPGAK98FdhS9xhOQL5oT57gnv8XPCbgJ2nqp6iYhHgAx7riYt0gWqaD0MNHgTG9IWDG-nTdZZsnDq2CyS3_2PIKJgvJWPGEBrmc-LHlSKJCIbGhZ3HZvinRV/s1600/january_2017_yankee_candle_haul_2.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh9eX1HJ-Jjl4Um2vCLtbDJIPGAK98FdhS9xhOQL5oT57gnv8XPCbgJ2nqp6iYhHgAx7riYt0gWqaD0MNHgTG9IWDG-nTdZZsnDq2CyS3_2PIKJgvJWPGEBrmc-LHlSKJCIbGhZ3HZvinRV/s1600/january_2017_yankee_candle_haul_2.JPG" /></a></div> <h2 style="clear: both; text-align: center;"> Happy 2017!</h2> <div> What better way to kick off the year than with a Yankee Candle haul? We all know I'm a little bit obsessed with their candles, and I love talking about the scents I'm trying every month. Having 3 pets, we always have candles burning since they cats are indoor pets and I hate the smell of cat litter. Let's see which scents I purchased this month.</div> <h3 style="text-align: center;"> YC Angel's Wings</h3> <div> I never really noticed this scent in stores, but I picked it up at random and gave it a sniff, and it's a beautiful, <b>sweet </b>scent. The notes are spun <b>sugar</b>, flower <b>petals </b>and <b>vanilla</b>, and they make for a perfect soft, sweet and calming scent that I love for my bedroom. If you'd like something sweet but similar to Soft Cotton, give this a go. Available <a href="http://www.yankeecandle.co.uk/product/angels-wings/_/R-1306396E112">here</a>, but currently sold out, and <a href="http://yankeecandle.si/catalogsearch/result/?q=angel%27s+wings">here </a>for Slovenian customers. The prices range from 20-27€.</div> <h3 style="text-align: center;"> YC All Is Bright</h3> <div> I believe this is part of the NY collection, though it doesn't smell at all wintery to me. It's <b>musky </b>and citrusy. With notes of redcurrant, <b>grapefruit </b>and musk, it's almost early spring-ish, more so than wintery, at least to my nose. I really like it though, it's refreshing but calming at the same time. Available <a href="http://www.yankeecandle.co.uk/product/all-is-bright/_/R-1513534E112">here </a>and <a href="http://yankeecandle.si/catalogsearch/result/?q=all+is+bright">here</a>.</div> <h3 style="text-align: center;"> YC Red Apple Wreath</h3> <div> I love <b>apple </b>notes in my candles. There's something about that tart <b>sweetness </b>that I just adore. This one is almost like a pie with <b>cloves</b>, apples, brown <b>sugar</b>, vanilla, maple syrup and vanilla. So yummy and so lovely. I'd really recommend it, it's one of my favorite apple scents. Available <a href="http://www.yankeecandle.co.uk/product/red-apple-wreath/_/R-1120699E112">here </a>and <a href="http://yankeecandle.si/catalogsearch/result/?q=Red+Apple+Wreath">here</a>.</div> <h3 style="text-align: center;"> YC Cinnamon Stick</h3> <div> I believe I've had this one before, if not, I had Home Sweet Home which is a very similar scent. Aside from cinnamon it also has bay leaf, clove and cedarwood, and it's a very homey, <b>sweet and spicy </b>scent. This one also lasts a long time, which I love. You can purchase it <a href="http://www.yankeecandle.co.uk/product/cinnamon-stick/_/R-1055975E112">here </a>or <a href="http://yankeecandle.si/catalogsearch/result/?q=Cinnamon+Stick">here</a>.</div> <div> <br /></div> <div> There we go, my latest YC haul. I'd love to try out some new candles this year. I've been eyeing some Woodwick scents in a local store which I really should try out soon.&nbsp;</div> <div style="text-align: center;"> <i><b>What's your favorite candle brand?</b></i></div> <br /></description>
<link>http://nothinfancyreally.blogspot.com/2017/01/january-2017-yankee-candle-haul.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg3JYb1CcBkyCEkszpBZ-t1-YcL7p3l7_AYbzydEKMAFxjJDqoo8CjVKsPC8C5LY8IwWkgrh6UUmns-7nondZwr9zKBGp9yTh7lvB6LnpVlBXVyBRC8LfKK3ryiRsrDW8_OABYwZjSI5C5R/s72-c/january_2017_yankee_candle_haul_1.JPG" height="72" width="72"/>
<thr:total>10</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-1575462453249786105</guid>
<pubDate>Tue, 06 Dec 2016 21:43:00 +0000</pubDate>
<atom:updated>2016-12-06T22:43:37.873+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">anastasia</category>
<category domain="http://www.blogger.com/atom/ns#">BECCA</category>
<category domain="http://www.blogger.com/atom/ns#">blush</category>
<category domain="http://www.blogger.com/atom/ns#">charlotte tilbury</category>
<category domain="http://www.blogger.com/atom/ns#">cult beauty</category>
<category domain="http://www.blogger.com/atom/ns#">eyebrows</category>
<category domain="http://www.blogger.com/atom/ns#">haul</category>
<category domain="http://www.blogger.com/atom/ns#">high end</category>
<category domain="http://www.blogger.com/atom/ns#">highlighter</category>
<category domain="http://www.blogger.com/atom/ns#">lipstick</category>
<category domain="http://www.blogger.com/atom/ns#">makeup</category>
<category domain="http://www.blogger.com/atom/ns#">shopping</category>
<category domain="http://www.blogger.com/atom/ns#">skincare</category>
<category domain="http://www.blogger.com/atom/ns#">sunday riley</category>
<title>Cult Beauty December 2016 Haul</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUbx3Abh1pDl0h5bGBDKWLfNjJSMFQWIwaXUCtjaRLpXQz_GP6zDoDQRDvYzVaJNT1dBunMOYx4I8EL3iWY7cOBDcqeM4IGND1mCjr-Kk4G92_-dH_Mw11u9UYnC23LGwc5vl1p1VPAR_g/s1600/cult_beauty_haul_december_2016_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUbx3Abh1pDl0h5bGBDKWLfNjJSMFQWIwaXUCtjaRLpXQz_GP6zDoDQRDvYzVaJNT1dBunMOYx4I8EL3iWY7cOBDcqeM4IGND1mCjr-Kk4G92_-dH_Mw11u9UYnC23LGwc5vl1p1VPAR_g/s1600/cult_beauty_haul_december_2016_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgO05kDPhzyk46xP4QEklAZYwZiUgNOAQwlpdTtp6desYLC5KTGirRO4ymwEePfdfLCBE2YhjlVZSVewp3Hz5m36RTzpAIu4SJyVjcaHbCY8diJm76xij68ewCO_IjGIuhbVor7ic6K8wxp/s1600/cult_beauty_haul_december_2016_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgO05kDPhzyk46xP4QEklAZYwZiUgNOAQwlpdTtp6desYLC5KTGirRO4ymwEePfdfLCBE2YhjlVZSVewp3Hz5m36RTzpAIu4SJyVjcaHbCY8diJm76xij68ewCO_IjGIuhbVor7ic6K8wxp/s1600/cult_beauty_haul_december_2016_2.jpg" /></a></div> <h3 style="clear: both; text-align: center;"> Because apparently, I don't shop enough...</h3> I spent a bit too much money on Cult Beauty the other day and I wanted to share my picks with you. I got the package yesterday and I haven't tried most of it yet, but at least I can share my first impressions.<br /> <h4 style="text-align: center;"> Becca Champagne Pop Highlighter</h4> Did you have any doubts about me picking this up? Of course I had to get this gorgeous <b>golden</b>, <b>shimmery </b>highlighter. I'm excited to use it - upon first swatch it's incredibly pigmented. Available <a href="https://www.cultbeauty.co.uk/becca-jaclyn-hill-shimmering-skin-perfector-pressed-champagne-pop.html?ref=homepage#clktrack&amp;type=product&amp;list=best-selling&amp;rk=1">here </a>for&nbsp;£32.<br /> <h4 style="text-align: center;"> Becca Luminous Blush in Foxglove</h4> <br /> I haven't heard too much hype about these blushes, but I absolutely adore a <b>luminous finish on my cheeks</b> and this shade was calling my name. A beautiful <b>deep pink</b> that I'm really excited to start using. Available <a href="https://www.cultbeauty.co.uk/becca-shimmering-skin-perfector-luminous-blush.html#rk=1&amp;w=foxglove&amp;clktrack&amp;type=product&amp;list=search">here&nbsp;</a>&nbsp;for&nbsp;£27.<br /> <h4 style="text-align: center;"> Charlotte Tilbury Matte Revolution Lipstick in Bond Girl</h4> I mean, no makeup junkie's collection is complete without a CT lipstick, right? I love the shade Bond Girl, it's a <b>brown with reddish undertones</b> that I think will work well on my skintone. The packaging is luxurious and lovely as well. Available <a href="https://www.cultbeauty.co.uk/charlotte-tilbury-matte-revolution.html">here </a>for&nbsp;£23.<br /> <h4 style="text-align: center;"> Anastasia Brow Wiz in Chocolate</h4> A repurchase after several months of trying different stuff and finally deciding nothing can compare to my dear Brow Wiz. The shade is perfect, my only qualm with this product is, <b>I go through it really fast</b>. Available <a href="https://www.cultbeauty.co.uk/anastasia-beverly-hills-brow-wiz.html">here </a>for&nbsp;£15.50.<br /> <h4 style="text-align: center;"> Sunday Riley Good Genes</h4> I had this stroke of genius and decided I absolutely MUST replace all my skincare with Sunday Riley products. Upon placing them all in my shopping bag I quickly deduced I'm not a billionaire yet, so I can't afford to revamp my whole skincare in one go... But I did pick up Good Genes and have been loving it so far. It's quite <b>thick </b>and I <b>don't love the scent</b>, but you can feel it working. Available <a href="https://www.cultbeauty.co.uk/sunday-riley-good-genes.html">here </a>for an extortionate&nbsp;£85. Why does no one mention the <b>stunning packaging</b> on this? It's perfect.<br /> <br /> I know I've been posting tons of hauls lately and I promise I'll do some reviews soon as well... I've just been shopping a lot!<br /> <div style="text-align: center;"> <b><i>What's your last beauty buy?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/12/cult-beauty-december-2016-haul.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjUbx3Abh1pDl0h5bGBDKWLfNjJSMFQWIwaXUCtjaRLpXQz_GP6zDoDQRDvYzVaJNT1dBunMOYx4I8EL3iWY7cOBDcqeM4IGND1mCjr-Kk4G92_-dH_Mw11u9UYnC23LGwc5vl1p1VPAR_g/s72-c/cult_beauty_haul_december_2016_1.jpg" height="72" width="72"/>
<thr:total>6</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-5294131564915053391</guid>
<pubDate>Sat, 26 Nov 2016 13:13:00 +0000</pubDate>
<atom:updated>2016-11-26T14:13:41.680+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">home decor</category>
<category domain="http://www.blogger.com/atom/ns#">interior design</category>
<category domain="http://www.blogger.com/atom/ns#">lifestyle</category>
<title>Mini Apartment Tour</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlF2qfn9zuxxYN9nYsFqYtRMSMX2NA33UrMwKnymyi_qdhfG9AGu-c-obDxxtcmcmbGYWASoqvDVgE3hivz58PybPRC_rxFoUIa7eDqDBdImHCeYD-PiNQn1vozgWn2ly4GeaSSksqT2wQ/s1600/apartment1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlF2qfn9zuxxYN9nYsFqYtRMSMX2NA33UrMwKnymyi_qdhfG9AGu-c-obDxxtcmcmbGYWASoqvDVgE3hivz58PybPRC_rxFoUIa7eDqDBdImHCeYD-PiNQn1vozgWn2ly4GeaSSksqT2wQ/s1600/apartment1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEilMzoFnzkCbq5QmLuYHiGOAoKeBRwy1g7QWO47areEurQR_0jZH4qYd368xI5WlnYWyObl0kQTGoIKnES4caBH3S9Vqus6cLqwNa7GWW3Tj45B0dG_T6_XINH7F8juEMoy2zbS0jyU50IC/s1600/apartment2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEilMzoFnzkCbq5QmLuYHiGOAoKeBRwy1g7QWO47areEurQR_0jZH4qYd368xI5WlnYWyObl0kQTGoIKnES4caBH3S9Vqus6cLqwNa7GWW3Tj45B0dG_T6_XINH7F8juEMoy2zbS0jyU50IC/s1600/apartment2.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgP3h0rr5KBkG1yBxxoRZOP22SKu6GsgkEpPjppdXVFnjI1GCiIJOSoufxHotU2BjK56hgTWfFDB7vyHg9C8S-M78uk1BVA-d-Nog7gg7d5szanw1E-iAnLw0OlUQ6AadxP83WzOuTvBqx-/s1600/apartment3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgP3h0rr5KBkG1yBxxoRZOP22SKu6GsgkEpPjppdXVFnjI1GCiIJOSoufxHotU2BjK56hgTWfFDB7vyHg9C8S-M78uk1BVA-d-Nog7gg7d5szanw1E-iAnLw0OlUQ6AadxP83WzOuTvBqx-/s1600/apartment3.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEju0sUGbXioABC9CqOMj8X4bNazFKWX8OuM6BqPUzo00Ca5S2PoCVQgSUas_pdYmnoVrWecvqq-0Ne5CWCOURsafXBWES4BMZWXIlXVmYsQ6y0BFimyObCqQC71Mpr7NEPL5h6npEcGojNY/s1600/apartment4.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEju0sUGbXioABC9CqOMj8X4bNazFKWX8OuM6BqPUzo00Ca5S2PoCVQgSUas_pdYmnoVrWecvqq-0Ne5CWCOURsafXBWES4BMZWXIlXVmYsQ6y0BFimyObCqQC71Mpr7NEPL5h6npEcGojNY/s1600/apartment4.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjlN5BVuvdPqSzICaRvEzlUsHlVivAbFX8cjbgNB4RWsl1M2x7bnEltSY_Vj1hj_Z1Feca2hNZ154zBnKcqJlAXLyZGMSDIVM-qOp0Je4tnXOFI8ENS6ufdJb6ZVSrQ8bk853joQi-NUN6V/s1600/apartment5.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjlN5BVuvdPqSzICaRvEzlUsHlVivAbFX8cjbgNB4RWsl1M2x7bnEltSY_Vj1hj_Z1Feca2hNZ154zBnKcqJlAXLyZGMSDIVM-qOp0Je4tnXOFI8ENS6ufdJb6ZVSrQ8bk853joQi-NUN6V/s1600/apartment5.jpg" /></a></div> <br /> <h2 style="text-align: center;"> Here's a little peak into our apartment!</h2> <div> I've been meaning to share some pictures for a while, but I just never feel like this place is finished/pretty enough, so I always put it off. We're doing a few more projects in it soon, so I'll make sure to share more pictures soon.</div> <div> <br /></div> <div> I hope you liked seeing these pics - personally, I just adore home decor posts, they're some of the most fun to read. :) I can't wait to show you the finished product as well.</div> <div> <br /></div> <div style="text-align: center;"> <b><i>What's your favorite homeware store?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/11/mini-apartment-tour.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlF2qfn9zuxxYN9nYsFqYtRMSMX2NA33UrMwKnymyi_qdhfG9AGu-c-obDxxtcmcmbGYWASoqvDVgE3hivz58PybPRC_rxFoUIa7eDqDBdImHCeYD-PiNQn1vozgWn2ly4GeaSSksqT2wQ/s72-c/apartment1.jpg" height="72" width="72"/>
<thr:total>11</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-5136867688557007271</guid>
<pubDate>Wed, 23 Nov 2016 17:29:00 +0000</pubDate>
<atom:updated>2016-11-23T18:29:22.059+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">beauty</category>
<category domain="http://www.blogger.com/atom/ns#">caudalie</category>
<category domain="http://www.blogger.com/atom/ns#">drugstore</category>
<category domain="http://www.blogger.com/atom/ns#">feelunique</category>
<category domain="http://www.blogger.com/atom/ns#">garnier</category>
<category domain="http://www.blogger.com/atom/ns#">haircare</category>
<category domain="http://www.blogger.com/atom/ns#">high end</category>
<category domain="http://www.blogger.com/atom/ns#">lipstick</category>
<category domain="http://www.blogger.com/atom/ns#">liquid lipstick</category>
<category domain="http://www.blogger.com/atom/ns#">makeup</category>
<category domain="http://www.blogger.com/atom/ns#">murad</category>
<category domain="http://www.blogger.com/atom/ns#">nyx</category>
<category domain="http://www.blogger.com/atom/ns#">ouai</category>
<category domain="http://www.blogger.com/atom/ns#">shopping</category>
<category domain="http://www.blogger.com/atom/ns#">skincare</category>
<category domain="http://www.blogger.com/atom/ns#">urban decay</category>
<category domain="http://www.blogger.com/atom/ns#">zoella</category>
<title>FeelUnique Fall Beauty Haul 2016</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQJUTIZF-dsEgyXr4mw7XiRfvIsvmbaHTTWsmAaclk26SMFO5YaW_JF5tQlAlJ0EncteOysssmLazaAtpNeli_kWdTHm4GCslvW49BNEFbJpvjYi5U91uzdVuM4lvv_uUC8slE8Mj7PjiR/s1600/feelunique_beauty_fall_haul_2016_1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQJUTIZF-dsEgyXr4mw7XiRfvIsvmbaHTTWsmAaclk26SMFO5YaW_JF5tQlAlJ0EncteOysssmLazaAtpNeli_kWdTHm4GCslvW49BNEFbJpvjYi5U91uzdVuM4lvv_uUC8slE8Mj7PjiR/s1600/feelunique_beauty_fall_haul_2016_1.JPG" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgoyoaciDJSyniG8794V5CjR9fRNgHgLLPTtQA6Jpw9FDaFCdYuQTLlQBAFwRBLN7BvfHp-8TneGS7ibubXwnecXhVOYIhIsRYMEgAK8B8o3zVOFueeyt8fVBzwabqaDLFftTyZXTMUKCRj/s1600/feelunique_beauty_fall_haul_2016_2.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgoyoaciDJSyniG8794V5CjR9fRNgHgLLPTtQA6Jpw9FDaFCdYuQTLlQBAFwRBLN7BvfHp-8TneGS7ibubXwnecXhVOYIhIsRYMEgAK8B8o3zVOFueeyt8fVBzwabqaDLFftTyZXTMUKCRj/s1600/feelunique_beauty_fall_haul_2016_2.JPG" /></a></div> <h4 style="text-align: center;"> Time for a quick FeelUnique haul!</h4> <div style="text-align: left;"> I haven't shopped on their website in ages and there were a few things I wanted to try out, along with a few Christmas gifts I needed to shop for, so here we go... I got a couple of products I've been lusting after for ages!</div> <h3 style="text-align: center;"> Murad Clarifying Cleanser</h3> <div> I've heard several Youtube gurus talking about this, namely MissTiffanyD who recommended it time and time again. While I don't suffer from acne anymore, my skin is still <b>blemish prone,</b> and I hope this will help keep impurities at bay, especially during that time of the month. You can purchase it <a href="https://eu.feelunique.com/p/Murad_clarifying_cleanser_200ml">here </a>for 25€. I've tried it out already and it has a strong <b>minty scent</b>, feels very refreshing.</div> <h3 style="text-align: center;"> Caudalie Vinoperfect Overnight Renewal Cream&nbsp;</h3> Lately I've been using the Caudalie Vinosource SOS Serum, which is arguably my favorite skincare item of all time, so I just had to try a few more things from them. Haven't tried this<b> night cream</b> out yet, but I'll apply it tonight before bed and keep you posted. Available <a href="http://eu.feelunique.com/p/Caudalie-Vinoperfect-Overnight-Renewal-Cream-40ml">here </a>for 41€.<br /> <h3 style="text-align: center;"> OUAI Texturizing Hair Spray</h3> I ran out of my Charles Worthington <b>Texturizing Spray</b> and man, do I miss it... I had to get an alternative and I've heard great things about OUAI so I thought I'd give it a try. The only annoying thing about ordering aerosols is, you have to pay for premier shipping since there are some regulations in the EU about them (goodbye, sweet sweet 20€). Available <a href="http://eu.feelunique.com/p/OUAI-Texturizing-Hair-Spray-130g">here </a>for 28€.<br /> <h3 style="text-align: center;"> Zoella Beauty Secret Scenta Fragrance Set</h3> Yes, I am a child for ordering this, but I don't care! Body mists last like 3 minutes on me so I got these for my bed linen, I just <b>love spraying my bed with a yummy scent before bed</b>. I'm a little disappointed in the gingerbread scent, it seems a little synthetic, but Sweet Inspirations is lovely. I have yet to try the others. Available <a href="http://eu.feelunique.com/p/Zoella-Beauty-Secret-Santa-Fragrance-Set">here </a>for 20€, and it would be such a cute gift for a friend for Christmas!<br /> <h3 style="text-align: center;"> Urban Decay All Nighter Makeup Setting Spray&nbsp;</h3> I got 10% off UD as a FeelUnique member (you can pick your favorite brand and always get 10% off it). I've wanted this spray for friggin' ages, and I can't wait to let you know if it works as well as everyone says. <b>Travel size </b>for now, because I want DeSlick next. Available <a href="http://eu.feelunique.com/p/Urban-Decay-All-Nighter-Makeup-Setting-Spray-Travel-Size-30ml">here</a>, 13€.<br /> <h3 style="text-align: center;"> NYX Lingerie Liquid Lipstick</h3> I got a few shades - <b>Teddy, Beauty Mark, Embellishment and Honeymoon</b>. I'm all about those brownish nudes at the moment and I'm really excited to try these. At 8€ a pop, they're one of the cheapest liquid lippies at the moment and I can't wait to wear them. Buy <a href="http://eu.feelunique.com/p/NYX-Lingerie-Liquid-Lipstick-4ml">here</a>.<br /> <h3 style="text-align: center;"> Garnier Micellar Water</h3> Oldie goldie, I always come back to this one in the end. My other favorites are Corine De Farme and Vichy, but I absolutely despise Bioderma, it makes my eyes sting and itch and dries them out. This was on offer for like 3€, now it's around 5 <a href="http://eu.feelunique.com/p/Garnier-Cleansing-Micellar-Water-400ml">here</a>.<br /> <br /> I got a few presents as well that I don't want to show, because someone might be reading this post! :P Can't wait to do some reviews on these goodies.<br /> <div style="text-align: center;"> <b><i>What was your last beauty buy?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/11/feelunique-fall-beauty-haul-2016.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQJUTIZF-dsEgyXr4mw7XiRfvIsvmbaHTTWsmAaclk26SMFO5YaW_JF5tQlAlJ0EncteOysssmLazaAtpNeli_kWdTHm4GCslvW49BNEFbJpvjYi5U91uzdVuM4lvv_uUC8slE8Mj7PjiR/s72-c/feelunique_beauty_fall_haul_2016_1.JPG" height="72" width="72"/>
<thr:total>0</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-7381396853000130651</guid>
<pubDate>Sun, 13 Nov 2016 19:33:00 +0000</pubDate>
<atom:updated>2016-11-13T20:33:29.117+01:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">candles</category>
<category domain="http://www.blogger.com/atom/ns#">home decor</category>
<category domain="http://www.blogger.com/atom/ns#">lifestyle</category>
<category domain="http://www.blogger.com/atom/ns#">yankee candle</category>
<title>Fall 2016 Yankee Candle Haul</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEie0sT2chPTTJBTqYvQ4IdNHquqfLZU3TtFsY5ZVmXBMsURH8L2kTV6GbtOSnw4sB8IaUJ_vKQBItTGcNE8jD_X7OZ_Vp22YNZkrf0HT-35zCQUcvEnAjXGh5ZbAH_qg0sZlbSAfqVg9xjr/s1600/yankee_candle_fall_2016_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEie0sT2chPTTJBTqYvQ4IdNHquqfLZU3TtFsY5ZVmXBMsURH8L2kTV6GbtOSnw4sB8IaUJ_vKQBItTGcNE8jD_X7OZ_Vp22YNZkrf0HT-35zCQUcvEnAjXGh5ZbAH_qg0sZlbSAfqVg9xjr/s1600/yankee_candle_fall_2016_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi-_Gsx-vfXjgFGCaCiTKcGzj5KyVeXdinnc30zQQAjHbs60HR3n5ZLtfDyy1uqfoESVq3f4mQUII2szK5eX7vdAjOHHI8Dfqe00C_OIouB5nA5mTUmvn5N-DMSIQKa32ME8JNUgmIMja4D/s1600/yankee_candle_fall_2016_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEi-_Gsx-vfXjgFGCaCiTKcGzj5KyVeXdinnc30zQQAjHbs60HR3n5ZLtfDyy1uqfoESVq3f4mQUII2szK5eX7vdAjOHHI8Dfqe00C_OIouB5nA5mTUmvn5N-DMSIQKa32ME8JNUgmIMja4D/s1600/yankee_candle_fall_2016_haul_2.jpg" /></a></div> <br /> <h4 style="text-align: center;"> <span style="font-size: large;">You know you haven't been posting on your blog enough when you have 2 candle hauls to do...</span></h4> <div> <span style="font-size: large;"><br /></span></div> <div> And here is the first one! I always love doing my Yankee hauls. Living with three pets can be messy (and stinky) which is why I always like to have a candle burning. I paid my monthly visit to the Yankee Candle store and picked out a few new scents.</div> <h3 style="text-align: center;"> YC Cranberry Pear</h3> <div> Well, hate to be a downer, but I don't like this scent at all - my boyfriend actually picked it out. I'm not a fan of <b>artificial fruit </b>scents, they smell a little <b>plastic</b>-y to me, but he loves it, so whatever. :P This doesn't smell like pear to me (a real shame because I ADORE pear and pear blossom notes), it does smell like cranberry though. Slovenian link <a href="http://yankeecandle.si/catalogsearch/result/?q=cranberry+pear">here</a>, international <a href="http://www.yankeecandle.co.uk/search?Ntt=cranberry+pear&amp;Ns=DefaultSort%7C0%7C%7Csku.displayName%7C0&amp;No=0&amp;Nrpp=10">here</a>.</div> <h3 style="text-align: center;"> YC Tarte Tatin</h3> <div> OMG, I think this is limited edition, and what a shame that is, because I freaking love it. Smells like <b>cinnamon with apple and pie crust</b>. Honestly, I just want to eat it! It makes me feel so cozy and happy, and I would really recommend this one for that autumn feel. Purchase <a href="http://yankeecandle.si/catalogsearch/result/?q=tarte+tatin">here </a>for Slovenia, <a href="http://www.yankeecandle.co.uk/search?Ntt=Tarte+Tatin&amp;Ntk=sku.fragranceName&amp;Ntx=mode+matchallpartial&amp;Ns=DefaultSort|0||sku.displayName|0">here </a>for international.</div> <h3 style="text-align: center;"> YC Honey Clementine</h3> <div> This one is long gone because I just had to use it up as soon as I got it. <b>Delicious, syrupy honey with fresh and zesty clementine</b> - a dream come true! I adored it. Oh, I think this is limited edition too - but at least the good news is the autumn line was a win for me. Buy it <a href="http://yankeecandle.si/catalogsearch/result/?q=Honey+Clementine">here </a>or <a href="http://www.yankeecandle.co.uk/search?Ntt=Honey+Clementine&amp;Ntk=product.categoryname&amp;Ntx=mode+matchallpartial&amp;Ns=DefaultSort|0||sku.displayName|0">here</a>, if not in Slovenia.</div> <div> <br /></div> <h3 style="text-align: center;"> YC Rhubarb Crumble</h3> <div> I think my boyfriend stole and burned this one, tsk tsk. <b>Smells fresh, zesty and has a baking note as well.</b> Very pleasant but not my favorite out of the autumn line, I preferred Tarte Tatin and Honey Clementine. Still a good scent to buy. Link <a href="http://yankeecandle.si/catalogsearch/result/?q=Rhubarb+Crumble">here</a>, international <a href="http://www.yankeecandle.co.uk/search?Ntt=Rhubarb+Crumble&amp;Ns=DefaultSort%7C0%7C%7Csku.displayName%7C0&amp;No=0&amp;Nrpp=10">here</a>.</div> <div> <br /></div> <div style="text-align: center;"> I just adore fall collections from Yankee Candle, and now I'm even more excited about the Christmas line! Can't wait to shop it next.&nbsp;</div> <div style="text-align: center;"> <b><i>What's your favorite candle scent?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/11/fall-2016-yankee-candle-haul.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEie0sT2chPTTJBTqYvQ4IdNHquqfLZU3TtFsY5ZVmXBMsURH8L2kTV6GbtOSnw4sB8IaUJ_vKQBItTGcNE8jD_X7OZ_Vp22YNZkrf0HT-35zCQUcvEnAjXGh5ZbAH_qg0sZlbSAfqVg9xjr/s72-c/yankee_candle_fall_2016_haul_1.jpg" height="72" width="72"/>
<thr:total>4</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-8255128872853346529</guid>
<pubDate>Thu, 08 Sep 2016 11:48:00 +0000</pubDate>
<atom:updated>2016-09-08T13:55:45.659+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">acne</category>
<category domain="http://www.blogger.com/atom/ns#">foundation</category>
<category domain="http://www.blogger.com/atom/ns#">la roche posay</category>
<category domain="http://www.blogger.com/atom/ns#">skincare</category>
<title>Effaclar Duo(+) Unifiant Review & Rave</title>
<description><div class="separator" style="clear: both; text-align: center;"> </div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh4Tm_wkqIqHpJwwA5ONcpTcEQQQq-ZkepTeB1wBBwF8hZmn9kgCVvx_Zfmhbr-tYX0sO7gFX7AeQ8-tgxYXSYsR8mmE2zI-Q02IB21rbsm14BilDIcOPOXhKZ6rucBuhJdOmY_Po4zWi0g/s1600/effaclar_unifiant_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh4Tm_wkqIqHpJwwA5ONcpTcEQQQq-ZkepTeB1wBBwF8hZmn9kgCVvx_Zfmhbr-tYX0sO7gFX7AeQ8-tgxYXSYsR8mmE2zI-Q02IB21rbsm14BilDIcOPOXhKZ6rucBuhJdOmY_Po4zWi0g/s1600/effaclar_unifiant_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhWgkkObeGxd3gAWE9bVXVjPvO_qYsQ8TkNdsXRWynt8XFJLntBoqlU2W7D2T_tQRtC0Zr7OzSb0Efq4lmVRk_oKGKJKoQ1U-Sm6_Ld2TzH7TosUo6AXWjvNqu1yVgI5wQTaKuxByRxRgXQ/s1600/effaclar_unifiant_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhWgkkObeGxd3gAWE9bVXVjPvO_qYsQ8TkNdsXRWynt8XFJLntBoqlU2W7D2T_tQRtC0Zr7OzSb0Efq4lmVRk_oKGKJKoQ1U-Sm6_Ld2TzH7TosUo6AXWjvNqu1yVgI5wQTaKuxByRxRgXQ/s1600/effaclar_unifiant_2.jpg" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <h3 style="text-align: center;"> <span style="text-align: center;">Have you ever wanted a skincare product that gave you an amazing coverage as well?</span></h3> <div class="separator" style="clear: both; text-align: left;"> If you've been reading my blog for a while, I'm sure you know I'm a huge fan of La Roche Posay. When I was younger and had acne, their Effaclar Duo treatment helped me a lot, and since then I've tried most of the range, including the gel, toner and A.I. products.&nbsp;</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> A few years ago, LRP came out with Effaclar Duo(+), which was my first disappointment in the range. After loving the original Duo, Duo(+) broke me out horribly, and it took me months to get rid of the red marks - and it was the first time I broke out because of a product as my skin isn't sensitive to them usually.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> So you can understand my hesitation when I was offered to try out the new <b>Duo(+)</b> product. This is a skincare treatment, but it is <b>tinted </b>and supposed to give you some <b>coverage </b>as well as treating your skin. In the end, I decided I had more wins than losses with LRP, and I gave it a go.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I wouldn't be writing this post if I didn't end up loving the product. I am really impressed with this - it has all the properties I loved with the original Duo and so many more new ones that I've fallen in love with. Instead of rambling on about it, I'm just going to post a pros/cons list below.</div> <h4 style="clear: both; text-align: left;"> Cons:</h4> <div class="separator" style="clear: both; text-align: left;"> </div> <ul> <li>The shade is a little <b>too dark </b>for me (Light), so I wish this came in a shade lighter.</li> </ul> <br /> <h4 style="clear: both; text-align: left;"> Pros:</h4> <div class="separator" style="clear: both; text-align: left;"> </div> <ul> <li>Gives a beautiful finish, not dewy, but not matte either (<b>semi-matte</b>)</li> <li>No shine peeks through, it's not heavy, but very <b>light </b>and feels like nothing on the skin.</li> <li>Smells wonderful and it is a pleasure to apply.</li> <li>Unbelievable <b>coverage</b>. I have huge pores and a lot of red marks, and this covered all of them.</li> <li>Affordable at around <b>14€</b>.</li> <li>Helps my skin while giving it the coverage it needs on a daily basis.</li> <li>Doesn't clump or look cakey,<b> doesn't sit in pores</b>, has never balled up on my skin.</li> <li>Coverage-wise, closer to foundation than a BB cream, but light nonetheless.</li> <li>Doesn't irritate, feels pleasant and lovely on the skin.</li> <li>Comes with <b>40 ml </b>of product.</li> </ul> <br /> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> Needless to say, I've fallen in love with this product and I've already gone through half a bottle. I work from home, and on days when I'm just in the flat or running errands, I couldn't wish for a better product. Love this.</div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <div class="separator" style="clear: both; text-align: center;"> <b><i>What is your favorite skincare product that gives coverage?</i></b></div> <div class="separator" style="clear: both; text-align: center;"> Keep reading for the Slovenian version of this post + a giveaway!</div> <div class="separator" style="clear: both; text-align: center;"> </div> <a name='more'></a><br /> <br /> <h3 style="text-align: center;"> Si si kdaj želela izdelek za nego kože, ki bi ti nudil tudi popolno prekrivnost?</h3> <div> Če moj blog spremljaš že dlje časa, se gotovo spomniš mojega navdušenja nad izdelki La Roche Posay. Preizkusila sem celotno linijo za problematično kožo, se navduševala nad originalnim Effaclar Duo in bila bitko z Duo(+).</div> <div> <br /></div> <div> Preden sem sprejela vabilo, da preizkusim Duo(+) Unifiant, sem oklevala kar nekaj časa, saj me je zadnji izdelek iz te linije razočaral. Po Duo(+) sem dobila hud 'breakout', rdečih madežev sem se znebila šele po nekaj mesecih, pa sploh nimam občutljive kože.</div> <div> <br /></div> <div> K sreči se zgodba pri novosti LRP ni ponovila - Unifiant me je popolnoma navdušil in ima sedaj častno mesto v moji rutini. Namesto da brbljam o tem, kako me je navdušil, sem pripravila kar seznam prednosti in slabosti. Ker ima slabost (po mojem mnenju) le eno, začnimo s to...</div> <h4> Slabosti</h4> <div> <ul> <li>Le<b> 2 odtenka</b>. Meni je Light nekoliko pretemen, vendar izgleda OK, če ga zmešam z Effaclar AI ali The Body Shop kapljicami za posvetlitev pudra.</li> </ul> <h4> Prednosti</h4> </div> <div> <ul> <li>Daje čudovit <b>semi-matte finiš</b>.</li> <li>Skozi podlago masten videz ne prodira, obenem pa je lahek in prijeten na koži.</li> <li>Čudovito diši in je prijeten za nanos.</li> <li>Neverjetna <b>prekrivnost </b>- je bolj podobna pudru kut BB kremi.</li> <li>Stane okrog <b>14€</b>, tako da je cena ugodna.</li> <li>Moji koži pomaga, obenem pa zakriva nepravilnosti.</li> <li>Ne useda se v pore, ne izgleda 'cakey', nikoli se ne 'svaljka' po koži - problem, ki sem ga imela pri tako originalnem Duo kot Duo(+).</li> <li><b>Ne draži kože</b> (niti malo), daje prijeten občutek, kot da nimaš na sebi ničesar.</li> <li>V embalaži je <b>40 ml </b>izdelka.</li> </ul> <div> Verjetno mi ni treba še enkrat poudariti, da me je izdelek navdušil. Porabila sem že pol tubice. Ker delam od doma, je Unifiant popoln, tudi za takrat, ko moram na hitro v trgovino. Toplo priporočam.</div> </div> <h3 style="text-align: center;"> <a href="https://www.facebook.com/nothinfancyreally/">Na mojem Facebook profilu te čaka tudi nagradna igra, v kateri lahko zadaneš čisto svoj Duo(+) Unifiant.</a></h3> <div> <br /></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/09/effaclar-duo-unifiant-review-rave.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh4Tm_wkqIqHpJwwA5ONcpTcEQQQq-ZkepTeB1wBBwF8hZmn9kgCVvx_Zfmhbr-tYX0sO7gFX7AeQ8-tgxYXSYsR8mmE2zI-Q02IB21rbsm14BilDIcOPOXhKZ6rucBuhJdOmY_Po4zWi0g/s72-c/effaclar_unifiant_1.jpg" height="72" width="72"/>
<thr:total>4</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-5494445490853744832</guid>
<pubDate>Wed, 10 Aug 2016 12:21:00 +0000</pubDate>
<atom:updated>2016-08-10T14:21:41.913+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">catrice</category>
<category domain="http://www.blogger.com/atom/ns#">drugstore</category>
<category domain="http://www.blogger.com/atom/ns#">eos</category>
<category domain="http://www.blogger.com/atom/ns#">essence</category>
<category domain="http://www.blogger.com/atom/ns#">haul</category>
<category domain="http://www.blogger.com/atom/ns#">makeup</category>
<category domain="http://www.blogger.com/atom/ns#">maybelline</category>
<category domain="http://www.blogger.com/atom/ns#">shopping</category>
<title>Summer 2016 Drugstore Makeup Haul</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQrwF_HZy5AlCdZm3DpWWkDNhWVy80OSz7LD-2VeocsS5LYLDiopjE3Y67B9lolwAQokFUNbNHQOsNFewnbzoWSWSyyZdvYe_Ai-PuHcJukfzvhLYVqHItWwrGi-d_CJzTzoXn7nQYz7mT/s1600/summer_drugstore_makeup_haul_2016_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQrwF_HZy5AlCdZm3DpWWkDNhWVy80OSz7LD-2VeocsS5LYLDiopjE3Y67B9lolwAQokFUNbNHQOsNFewnbzoWSWSyyZdvYe_Ai-PuHcJukfzvhLYVqHItWwrGi-d_CJzTzoXn7nQYz7mT/s1600/summer_drugstore_makeup_haul_2016_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgSeUi1FdPOPkhTac7ihWzQpWeIXmh8sElGQ6-kK8RJLz-k-hOYxyjHtHOtIXH034rbbgEg_iwA4kUxPGyUz1V0WAxx7-5OJXI1RWn0NTQAzo_3BKb8pj55mNttooSqxEZT_s9cCF5ZN9oq/s1600/summer_drugstore_makeup_haul_2016_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgSeUi1FdPOPkhTac7ihWzQpWeIXmh8sElGQ6-kK8RJLz-k-hOYxyjHtHOtIXH034rbbgEg_iwA4kUxPGyUz1V0WAxx7-5OJXI1RWn0NTQAzo_3BKb8pj55mNttooSqxEZT_s9cCF5ZN9oq/s1600/summer_drugstore_makeup_haul_2016_2.jpg" /></a></div> <h2 style="clear: both; text-align: center;"> Hello ladies!</h2> <div> I went on a little shopping spree in my nearby Drogerie Markt, and I wanted to share my buys with you today. I've been meaning to pick up some new lipsticks, and I also needed a new powder, but of course I ended up with waaay too much stuff yet again. Let's see what we have...</div> <h3 style="text-align: center;"> EOS Lip Balm Strawberry Sorbet</h3> <div style="text-align: left;"> I know the hype for these has kind of died down, but I just discovered them recently and I am in. Freaking. Love. My favorite is the <b>sweet mint</b> scent, but I wanted another one for my collection. It's super fruity and sweet, and it moisturizes well without being oily (it's more <b>waxy</b>). These are expensive for lipbalm, about 7€ a pop, but compared to stuff like the by Terry Baume De Rose, I'm fine with paying that. Of course, my puppy already chewed it up... Oh well.&nbsp;</div> <h3 style="text-align: center;"> Maybelline Vivid Matte Liquid Lipsticks</h3> <div style="text-align: left;"> I saw a few reviews for these, and I already have a red shade, so I wanted to pick up a few more. So far I've only worn <b>05 Nude Flush</b> (I also got a vampier shade, <b>45 Possessed Plum</b>), and it felt my lips weirdly <b>tingly</b>... This didn't happen with the red shade, so I'm wondering what the problem was - almost felt like a slight allergic reaction! I love the shade though. These are about 9€ and you can purchase them <a href="http://eu.feelunique.com/p/Maybelline-New-York-Color-Sensational-Vivid-Matte-Liquid-Lipstick-8ml">here</a>.</div> <h3 style="text-align: center;"> Catrice All Matt Powder</h3> <div style="text-align: left;"> I adore Catrice powders. I've tried most of them, but not this one, so I had to get it for about 4€. I've tried it already and it's absolutely lovely. <b>Very smooth, finely milled</b> and absolutely lovely. Will repurchase for sure. I think powders are definitely something you can get from the drugstore without giving up the quality.</div> <h3 style="text-align: center;"> Catrice Blush Artist Shading Palette</h3> <div style="text-align: left;"> Got this in the shade 020 CorAll I Need. Pretty, but nothing special. They're not really blushes as they're quite sheeny and <b>don't have a lot of color payoff</b>. I would sooner use them as blush overlays. About 5€ for this palette. The shades are very pretty, though.</div> <h3 style="text-align: center;"> Catrice Deluxe Glow Highlighter</h3> <div> I haven't tried everything from this palette yet, but it seems great. The left <b>highlighter </b>is lovely, and the <b>bronzier </b>shade is good for contouring for Snow Whites like me (seriously, where is my tan, it's summer). Same price as the blush palette, I would recommend this one over the previous product.</div> <h3 style="text-align: center;"> Catrice Pret-a-Volume Smokey Mascara Velvet Black</h3> <div> I mean, this is an okay mascara, just a little <b>disappointing</b> to me. The result seems quite <b>natural</b>, and I was expecting something extremely dramatic. Seeing the brush, I was sure it would smudge and crumble, but thankfully it doesn't do that. Not my favorite. About 6€.</div> <h3 style="text-align: center;"> Catrice Fluid Lipstick Intense</h3> <div> Got this in the shade 040 Rose Your Voice! Haven't tried it yet, but the swatch was lovely. I'm super into these rosey, nude shades lately. I'll keep you posted on this one. I think it was about 4€.</div> <h3 style="text-align: center;"> Catrice Matt Lip Artist</h3> <div> These crayons are just lovely. I got two shades, <b>030 Barberry Hopping</b> and &nbsp;<b>010 Bare Nude's Soul</b>. One is more nude, &nbsp;the other more red. I was initially afraid these would end up on my teeth as they're very creamy, but they seem fine. Love the <b>matte dry down</b> and the price - 5€. I think these are limited edition, which is really a shame.</div> <h3 style="text-align: center;"> Catrice High Glow Mineral Highlighting Powder</h3> <div style="text-align: left;"> I couldn't resist, it's so pretty! But unfortunately, this highlighter is <b>way too shimmery</b> for me. It's finely milled, but just not a great product. I wish the color was darker as well, as it's too light even for me, and that's saying something. It costs about 4€.</div> <h3 style="text-align: center;"> Catrice Camouflage Concealer</h3> <div style="text-align: left;"> Been hearing great stuff about this. I want to do a comparison to Urban Decay Naked. Pretty sure I had it before and loved it! It costs around 5€. It is very <b>velvety and smooth</b>.</div> <h3 style="text-align: center;"> Essence The Beach House Blusher</h3> <div style="text-align: left;"> Isn't this adorable?! I want to get back into Essence blushers, I used to purchase them with every limited collection and they're absolutely lovely (anyone remember their Marble collection from years ago? That was probably my favorite blusher of all time). This was on sale for about 2€, since it's an older collection.</div> <h3 style="text-align: center;"> Catrice Ultimate Stay Lipsticks</h3> <div style="text-align: left;"> I absolutely adore these, and they're a bargain at around 5€. I got two shades, <b>070 Plum &amp; Base</b> and <b>060 Floral Coral</b>. Beautiful shades, pleasant application and they feel great on the lips. I want every shade!</div> <div style="text-align: left;"> <br /></div> <div style="text-align: left;"> Hope you enjoyed this haul! I'm really excited about another brand arriving in Slovenia - L.O.V., and I might be picking up some bits from them as well. Until next time!</div> <div style="text-align: center;"> <b><i>What's your favorite drugstore makeup item?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/08/summer-2016-drugstore-makeup-haul.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgQrwF_HZy5AlCdZm3DpWWkDNhWVy80OSz7LD-2VeocsS5LYLDiopjE3Y67B9lolwAQokFUNbNHQOsNFewnbzoWSWSyyZdvYe_Ai-PuHcJukfzvhLYVqHItWwrGi-d_CJzTzoXn7nQYz7mT/s72-c/summer_drugstore_makeup_haul_2016_1.jpg" height="72" width="72"/>
<thr:total>5</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-6121546206211742856</guid>
<pubDate>Mon, 18 Jul 2016 13:42:00 +0000</pubDate>
<atom:updated>2016-07-18T15:42:03.862+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">haul</category>
<category domain="http://www.blogger.com/atom/ns#">hm</category>
<category domain="http://www.blogger.com/atom/ns#">home</category>
<category domain="http://www.blogger.com/atom/ns#">home decor</category>
<category domain="http://www.blogger.com/atom/ns#">interior design</category>
<category domain="http://www.blogger.com/atom/ns#">online shopping</category>
<category domain="http://www.blogger.com/atom/ns#">shopping</category>
<title>H&M Home Haul</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjFESEeQ-pJrWPGzk972V90eONdpVTuoi0T-rEbBeR7Z78824HPVVYFPK-pPuxCraRi3cUFdXbQgP8LGt9bZAxzXGz4RIPazqDhBkUTrzimKE1lJrkprWm4UgD_sPWv1-L0Rthu3eBk5o30/s1600/hm_home_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjFESEeQ-pJrWPGzk972V90eONdpVTuoi0T-rEbBeR7Z78824HPVVYFPK-pPuxCraRi3cUFdXbQgP8LGt9bZAxzXGz4RIPazqDhBkUTrzimKE1lJrkprWm4UgD_sPWv1-L0Rthu3eBk5o30/s1600/hm_home_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEianf7hAZMCY8J8ThjHCr43RcZgKTtKp0_EagbRmx-EDrg61BCEmWPrkCXeb4JSBLwJ-tHO0VdbiE8JStv2tKkOhA8ADEIFjhaHc2G0qIC40lTlIwnSBa4E3CQ8r7qaSQqYJyfK-m1CWd3M/s1600/hm_home_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEianf7hAZMCY8J8ThjHCr43RcZgKTtKp0_EagbRmx-EDrg61BCEmWPrkCXeb4JSBLwJ-tHO0VdbiE8JStv2tKkOhA8ADEIFjhaHc2G0qIC40lTlIwnSBa4E3CQ8r7qaSQqYJyfK-m1CWd3M/s1600/hm_home_haul_2.jpg" /></a></div> <h3 style="text-align: center;"> I've been shopping like crazy...</h3> <div> And I feel like I'm getting old, because nothing feels as good as shopping for things for my home at the moment! :) I placed an order on H&amp;M Home and today I wanted to share a few cute things I picked up from them. I'm so excited they started delivering their home things to Slovenia!</div> <div> <br /></div> <div> Let's start of with this <a href="http://www2.hm.com/en_eur/productpage.0278852011.html"><b>grey blanket</b></a>, which comes in a few other colors (here's hoping I can eventually convince my boyfriend to get the pink one as well). It costs 30€ and it's incredibly <b>soft</b>, perfect for snuggling up! I'm kind of getting tired of those super soft polyester blankets because they get ruined fast and don't look very expensive, so this is a great alternative.</div> <div> <br /></div> <div> I also got a whole bunch of <b>candles</b>: <a href="http://www2.hm.com/en_eur/productpage.0340895026.html">Honey Blossom</a> - a sweeter scent, <a href="http://www2.hm.com/en_eur/productpage.0340895013.html">Green Tea</a> - sharp and citrusy, and <a href="http://www2.hm.com/en_eur/productpage.0340895015.html">Cotton Flower</a> - gentle and soft. I'm so glad I was able to get a few candles from H&amp;M, I love them and they're a good <b>bargain </b>at only 8€.</div> <div> <br /></div> <div> My favorite buy is probably this beautiful <b><a href="http://www2.hm.com/en_eur/productpage.0399148001.html">round vase</a></b>, which is glass and has a<b> gold rim</b> on top. I think it would look stunning with peonies, which I really need to buy if they're even still in season! The vase costs 20€, and there is also a smaller version available.</div> <div> <br /></div> <div> I got a cute <b><a href="http://www2.hm.com/en_eur/productpage.0352684002.html">napkin holder</a></b> which goes nicely with the coasters I showed you in my Zara haul. It cost 8€ which is a bit stupid since it's just a bit of metal... And it also comes in rose gold.</div> <div> <br /></div> <div> Finally, because I am a child, I got a <b><a href="http://www2.hm.com/en_eur/productpage.0310194001.html">plate </a></b>and <b><a href="http://www2.hm.com/en_eur/productpage.0309988001.html">mug </a></b>with a <b>cat motif</b>. Of course I had to buy them, do you even know me? :P I think they're adorable, and I'm pretty sure they're meant for children, but I'll probably use them for photos and decor. They are both 6€ and there is also a <a href="http://www2.hm.com/en_eur/productpage.0310153001.html">bowl </a>available.</div> <div> <br /></div> <div> I'll definitely order from H&amp;M home again. I keep wishing these companies did furniture as well because I'm sure it would be adorable. But until they get on that bandwagon, I'm happy with their cute decor stuff!</div> <div style="text-align: center;"> <b><i>What's the last thing you bought for your apartment?</i></b></div> <div style="text-align: center;"> <br /></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/07/h-home-haul.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjFESEeQ-pJrWPGzk972V90eONdpVTuoi0T-rEbBeR7Z78824HPVVYFPK-pPuxCraRi3cUFdXbQgP8LGt9bZAxzXGz4RIPazqDhBkUTrzimKE1lJrkprWm4UgD_sPWv1-L0Rthu3eBk5o30/s72-c/hm_home_haul_1.jpg" height="72" width="72"/>
<thr:total>14</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-4612932985014055674</guid>
<pubDate>Wed, 13 Jul 2016 10:25:00 +0000</pubDate>
<atom:updated>2016-07-13T12:25:49.093+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">bodycare</category>
<category domain="http://www.blogger.com/atom/ns#">elie saab</category>
<category domain="http://www.blogger.com/atom/ns#">haul</category>
<category domain="http://www.blogger.com/atom/ns#">perfume</category>
<category domain="http://www.blogger.com/atom/ns#">shopping</category>
<category domain="http://www.blogger.com/atom/ns#">skincare</category>
<category domain="http://www.blogger.com/atom/ns#">the body shop</category>
<title>Mini Summer Airport Haul</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj8Ho8PuXZ9a_bBc0LF8Nef0wESyMmKY5IQCoViOPJEFkpKj-vYYLP3eU211_JIRHaYlciiS7VtQaT8OE3u-METvlZoDBeeL47_CUzQERI4M6KqM2kUSisnUTVU1RsOEdcK4oYo-B-WKeep/s1600/summer_airport_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj8Ho8PuXZ9a_bBc0LF8Nef0wESyMmKY5IQCoViOPJEFkpKj-vYYLP3eU211_JIRHaYlciiS7VtQaT8OE3u-METvlZoDBeeL47_CUzQERI4M6KqM2kUSisnUTVU1RsOEdcK4oYo-B-WKeep/s1600/summer_airport_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlalaYGY71Ox8_Gn1yi9_3v4SA_w0dHcn_C4NB7VY_Dxc5OeG0lGJ0PJEbUK3VPjCBVNZp1GUU4UwomwbH3-DleMRy3Lp6H75zGJdRyEKdx9r-h65hGjzfQ_heSMGLUbMdvXzzaXCQ5CAN/s1600/summer_airport_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhlalaYGY71Ox8_Gn1yi9_3v4SA_w0dHcn_C4NB7VY_Dxc5OeG0lGJ0PJEbUK3VPjCBVNZp1GUU4UwomwbH3-DleMRy3Lp6H75zGJdRyEKdx9r-h65hGjzfQ_heSMGLUbMdvXzzaXCQ5CAN/s1600/summer_airport_haul_2.jpg" /></a></div> <h2 style="clear: both; text-align: center;"> What's a girl to do when she gets to the airport 3 hours too early?</h2> <div> Well, shop - of course! I only ended up getting a few bits but I still wanted to show you my haul from the Nice airport. They have a tiny Duty Free and I wasn't that into the stuff there, but I still managed to pick up 4 new products.</div> <h3 style="text-align: center;"> Perfume</h3> <div> Starting with perfume, I got a long-coveted scent - <b>Elie Saab Le Parfum L'Eau Couture EDT</b>.&nbsp;This scent is absolutely divine and so, so special. It doesn't have a lot of notes, mainly vanilla, orange blossom and green almond. I smell all of those and they make for the loveliest soft scent. It's inoffensive and perfect for hot summer days when you don't want to wear something as cloying as Bronze Goddess, for example. I love it! Available <a href="http://www.allbeauty.com/1060294-elie-saab-leau-couture-eau-de-toilette-spray-90ml">here&nbsp;</a>&nbsp;from 62€.</div> <h3 style="text-align: center;"> Body</h3> <div> Next up, I found a well-stocked <b>TBS </b>section and I just had to pick up a few things. I was very curious about the English Rose range, but they didn't have testers and I decided to be a sensible human being and not blind buy. I did however, find some bits from the <b>Honeymania </b>range, and ended up getting the<b> Body Butter</b> and<b> Shower Gel </b>from the line. So excited about these - honey is my favorite note of all time. Body butters are around 15€, and the shower gel was 6,40€.</div> <div> <br /></div> <div> I also grabbed a <b>Strawberry Body Polish</b> from <b>The Body Shop</b>, which is a product I've had before and really loved. I don't remember the scent being quite so sickly sweet, but I'll still use it up. I know my boyfriend will love it, even if I don't. The body polish cost around 8€.</div> <div> <br /></div> <div> That's it, my teeny tiny France haul! I wanted to wander into Sephora, but the only time I was there, I was completely exhausted and couldn't handle it (shock! horror!) Next time for sure, though... I have a few more trips in my future. ;)</div> <div style="text-align: center;"> <b><i>What was your last summer beauty buy?</i></b></div> <div style="text-align: center;"> <br /></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/07/mini-summer-airport-haul.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj8Ho8PuXZ9a_bBc0LF8Nef0wESyMmKY5IQCoViOPJEFkpKj-vYYLP3eU211_JIRHaYlciiS7VtQaT8OE3u-METvlZoDBeeL47_CUzQERI4M6KqM2kUSisnUTVU1RsOEdcK4oYo-B-WKeep/s72-c/summer_airport_haul_1.jpg" height="72" width="72"/>
<thr:total>10</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-3583062999720273860</guid>
<pubDate>Tue, 12 Jul 2016 11:00:00 +0000</pubDate>
<atom:updated>2016-07-12T13:00:37.740+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">home</category>
<category domain="http://www.blogger.com/atom/ns#">home decor</category>
<category domain="http://www.blogger.com/atom/ns#">interior design</category>
<category domain="http://www.blogger.com/atom/ns#">zara</category>
<title>ZARA Home Haul</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgPSokUkcTRk3WMmltLQhnyet6rLlAX2CnJZbu6tUtg36EYei0kGnf44ygdnvF-ETfYcMbf1gHpZhlVlK6y7OkyIuftGe0fopi6uIpi8hx6GqyK3QtGxsUPWtz8k2VPsPsDNEDLwmKZtWZG/s1600/zara_home_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgPSokUkcTRk3WMmltLQhnyet6rLlAX2CnJZbu6tUtg36EYei0kGnf44ygdnvF-ETfYcMbf1gHpZhlVlK6y7OkyIuftGe0fopi6uIpi8hx6GqyK3QtGxsUPWtz8k2VPsPsDNEDLwmKZtWZG/s1600/zara_home_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgdgjc1AKaeTrpOtMN-Keqg3y-waJ1JfMI5oMljeBoweKvzx25_GbWs0oIMM5b57AVmS6DhGljditY0r-dJusj9_kcDjc9jIeB1sOtumrTeQHn8ykiEBKR-fBB5QS8WMI3Fb_h8pwHVVyQQ/s1600/zara_home_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgdgjc1AKaeTrpOtMN-Keqg3y-waJ1JfMI5oMljeBoweKvzx25_GbWs0oIMM5b57AVmS6DhGljditY0r-dJusj9_kcDjc9jIeB1sOtumrTeQHn8ykiEBKR-fBB5QS8WMI3Fb_h8pwHVVyQQ/s1600/zara_home_haul_2.jpg" /></a></div> <h2 style="clear: both; text-align: center;"> I'm back from France!</h2> <div class="separator" style="clear: both; text-align: left;"> You know what the best part of coming home is? Yep, finding a bunch of new packages waiting for you. :) ZARA Home recently started delivering to Slovenia, and since I love their home stuff, I needed to order a few things for our apartment. Here's what I got.</div> <h3 style="clear: both; text-align: center;"> Kitchen/dining</h3> <div class="separator" style="clear: both; text-align: left;"> Let's start the haul with these gorgeous <b>gold coasters</b>. Our living room is kind of oak-gold-white themed, with some grey as well, so these look lovely, mixed with our current bamboo coasters as well. These were in the sale and are out of stock now, but you can check out more coasters <a href="http://www.zarahome.com/si/tableware/coasters-c1293676.html">here</a>.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I also got 4 of the cutest geometrical <b>white mugs</b>, because we need to clean out our mug collection - we have a bunch of them that don't match at all, which bugs me to no end. These are 7€ a pop <a href="http://www.zarahome.com/si/tableware/mugs/diamond-pattern-porcelain-mug-c1293663p6909004.html">here</a>.</div> <div class="separator" style="clear: both;"> <br /></div> <div class="separator" style="clear: both;"> A set of <b>tea towels</b> also found its way into my basket. I find we're always ruining them and they need to be replaced quite fast. Again, these are out of stock, but you can check out more tea towels&nbsp;<a href="http://www.zarahome.com/si/tableware/kitchen-textiles-c1293671.html">here</a>.</div> <h3 style="text-align: center;"> Bathroom</h3> <div class="separator" style="clear: both; text-align: left;"> I got this really nice set <a href="http://www.zarahome.com/si/bathroom/accessories/black-and-white-bathroom-set-c1293648p7191002.html"><b>of a glass and soap dispenser</b></a> in white with a black border. I think they look really chic and they look great in our bathroom. I also got a white soap dispenser for our toilet. The prices for these range around 8€, and I think they look so classy in the bathroom.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I couldn't get past this <b>tissue box</b> with mother of pearl design. It was a bit of a disappointment as it's basically just a mask that you put over a paper box of tissues, but it still looks very pretty. I think it will look nice in my bedroom as well. It was crazy expensive (for what it is) though, so I'd think before ordering. I can't find it on the website but it was around 35€.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> Missing in action is a grey bathmat I just couldn't make look good in the picture, oops! Overall I was pleased with my order - everything's a bit overpriced but the items are lovely.</div> <div class="separator" style="clear: both; text-align: left;"> <br /></div> <div class="separator" style="clear: both; text-align: left;"> I also placed a cheeky order on H&amp;M home, which will probably be my next post. I have a tiny The Body Shop haul from the airport as well, so that will be coming in the next few days for all my beauty lovers. Hope you're keeping cool guys - this heat is killing me!</div> <div class="separator" style="clear: both; text-align: center;"> <b><i>What is the last thing your bought for your home?</i></b></div> <div style="text-align: center;"> <br /></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/07/zara-home-haul.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgPSokUkcTRk3WMmltLQhnyet6rLlAX2CnJZbu6tUtg36EYei0kGnf44ygdnvF-ETfYcMbf1gHpZhlVlK6y7OkyIuftGe0fopi6uIpi8hx6GqyK3QtGxsUPWtz8k2VPsPsDNEDLwmKZtWZG/s72-c/zara_home_haul_1.jpg" height="72" width="72"/>
<thr:total>9</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-5922211252216933362</guid>
<pubDate>Wed, 22 Jun 2016 16:31:00 +0000</pubDate>
<atom:updated>2016-06-22T18:31:29.964+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">catrice</category>
<category domain="http://www.blogger.com/atom/ns#">china glaze</category>
<category domain="http://www.blogger.com/atom/ns#">ciate</category>
<category domain="http://www.blogger.com/atom/ns#">essie</category>
<category domain="http://www.blogger.com/atom/ns#">nail polish</category>
<category domain="http://www.blogger.com/atom/ns#">rimmel</category>
<title>Pastel Nail Polish For Summer 2016</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaGKLPRyHUFGXXJFF1kkfkVSPOpkfp5nCej0s9DioSRHjxy3AvygKPSTmbQVFzy5H3QS4lpSJFQSTD64BlkGzTtqTsWVVOiIy7b_aaKvhbXeZXXa5v5Es7A7fJ5X07_DyXEGB3frASSUs0/s1600/spring_2016_best_nail_polish_shades_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaGKLPRyHUFGXXJFF1kkfkVSPOpkfp5nCej0s9DioSRHjxy3AvygKPSTmbQVFzy5H3QS4lpSJFQSTD64BlkGzTtqTsWVVOiIy7b_aaKvhbXeZXXa5v5Es7A7fJ5X07_DyXEGB3frASSUs0/s1600/spring_2016_best_nail_polish_shades_1.jpg" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEisOtUFZFs-nwaJg3Q82pIGsemBt_2R6wHxK8XNoNlvhQ6m-r3bExeULEmQmN3tKEpI-fHpgopuFLxiwdRC7SbUFV-NyXjFLbE90-nLS6T2lP2HNNuqC2t5PG745GRVmgXxUMEq4VbEF87a/s1600/spring_2016_best_nail_polish_shades_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEisOtUFZFs-nwaJg3Q82pIGsemBt_2R6wHxK8XNoNlvhQ6m-r3bExeULEmQmN3tKEpI-fHpgopuFLxiwdRC7SbUFV-NyXjFLbE90-nLS6T2lP2HNNuqC2t5PG745GRVmgXxUMEq4VbEF87a/s1600/spring_2016_best_nail_polish_shades_2.jpg" /></a></div> <div class="separator" style="clear: both; text-align: center;"> <br /></div> <h2 style="clear: both; text-align: center;"> Time for some bright pastels!</h2> <div class="separator" style="clear: both; text-align: left;"> I adore wearing brighter nail polish in spring and summer, so I prepared a round up of my favorite shades for the coming summer months. I'd love to know what you'll be reaching for in these sweltering hot days, as well :) Let's see which ones I've been loving...</div> <h3 style="clear: both; text-align: center;"> The perfect nude</h3> <b>China Glaze Don't Honk Your Thorn</b> has been on my nails a lot. It's one of those <b>nude taupe </b>shades that looks absolutely stunning on tanned skin (not that I'm tan... In fact, my mother kindly pointed out my legs were 'scary pale' just yesterday). This shade is really beautiful though, and it makes nails look longer somehow. Easy to apply as it's quite watery for a pastel, opaque in 2-3 coats. Price is around 6€.<br /> <h3 style="text-align: center;"> Bright as can be</h3> This stunning coral shade is by <b>China Glaze</b>, called <b>Petal to the Metal</b>. A stunning <b>bright pastel</b> - how do they manage that? Those two terms basically don't go together, but it's exactly what this is. A <b>peach coral</b> shade that looks stunning in the summer. I just adore ChG's formula, so easy to apply. Also around 6€.<br /> <h3 style="text-align: center;"> A wash of blue</h3> <b>Catrice 114 The Sky So Fly</b> is a calm blue shade that isn't particularly vibrant, but makes an impact with any outfit. I love the relaxed <b>cool blue which looks chic and modern</b>. And it's a bargain at around 3€ in drugstores! Opaque in 2 coats and easy to apply. I love these watery pastels, so much better to work with and not streaky at all.<br /> <h3 style="text-align: center;"> Blueberry ice-cream</h3> This <b>Rimmel </b>nail polish was a totally random find which cam in a beauty subscription box. The shade is<b> Lovely Lilac</b>, and I love that it's more a muted grey/purple color than some brighter violets. Really pretty and easy to apply. You might notice throughout this post that I am really damn lazy with my nail polish - it better apply well or I'm over it! I think this is around 4€.<br /> <h3 style="text-align: center;"> The perfect cotton candy pink</h3> <div> <b>China Glaze In a Lily Bit</b>. Wham, bam, thank you ma'am. Easy to apply, pretty and chips like a mofo, but I can overlook that fact as it's just such a pretty color, and it's actually not a pain to apply (unlike the next shade). A bargain at around 6€ and one of my top 3 nail polishes of all time!</div> <h3 style="text-align: center;"> Pale pink &amp; pretty</h3> <b>Essie Romper Room</b> is the one I have, but it was limited edition, so you could also get Fiji (but that one is pinker). I adore pastel pink nails, and this one is <b>very very light, with only a hint of pink</b> to it. If you want something more pink, go for the ChG color above. Essies are around 10€ unless you catch them on a 2 for 1 offer, and they're some of my favorite polishes.<br /> <h3 style="text-align: center;"> Peach Pink</h3> <b>Ciaté in Hoopla</b> is the perfect <b>coral/peach/pink</b> color. Light, pastel and so very pretty. It takes a few more coats to make this one opaque, but I just love this brand's packaging (and will admit I mostly buy them for that cute bow). It's around 9€ in drugstores. Check out their gold glitter as well!<br /> <h3 style="text-align: center;"> Forget-me-not</h3> This blue by <b>China Glaze</b> is one of the best polishes in my collection. A muted shade as opposed to those bright, neon &amp; vibrant blues we usually wear, it's so chic and pretty at the same time. The shade is <b>What a Pansy</b> and the price is around 6€.<br /> <br /> <div style="text-align: center;"> <b><i>What is your favorite nail polish of the summer?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/06/pastel-nail-polish-for-summer-2016.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgaGKLPRyHUFGXXJFF1kkfkVSPOpkfp5nCej0s9DioSRHjxy3AvygKPSTmbQVFzy5H3QS4lpSJFQSTD64BlkGzTtqTsWVVOiIy7b_aaKvhbXeZXXa5v5Es7A7fJ5X07_DyXEGB3frASSUs0/s72-c/spring_2016_best_nail_polish_shades_1.jpg" height="72" width="72"/>
<thr:total>8</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-444991089827104732</guid>
<pubDate>Sun, 19 Jun 2016 14:03:00 +0000</pubDate>
<atom:updated>2016-06-19T16:03:27.871+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">candle</category>
<category domain="http://www.blogger.com/atom/ns#">home decor</category>
<category domain="http://www.blogger.com/atom/ns#">lifestyle</category>
<category domain="http://www.blogger.com/atom/ns#">yankee candle</category>
<title>Summer 2016 Yankee Candle Haul</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnNUBJ7FGAvXURSiKKpu2l48hZY5ss2v_3mc7fu8DsKYrOWg6gBkvAiG3JJ_Upo85B8u2HP_9I8CXJVRK1sbxXadShJEZFwbBsaKv-q_9ZGNKDal8GRMb48RbAwo-kgSXdPKuYIoAP3xG0/s1600/summer_yankee_candle_haul_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnNUBJ7FGAvXURSiKKpu2l48hZY5ss2v_3mc7fu8DsKYrOWg6gBkvAiG3JJ_Upo85B8u2HP_9I8CXJVRK1sbxXadShJEZFwbBsaKv-q_9ZGNKDal8GRMb48RbAwo-kgSXdPKuYIoAP3xG0/s1600/summer_yankee_candle_haul_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh2SKL4H0pf-AQB6g0b8tflTl7qL2cEotL4CVHEcAITCcU22Ez64dFfrelXyM2FIZ3ZNd7wvZ0KxgJ_pPDbGJbC8IEf13L2YqLn_Z2Z5r-gFXuZK6S-ed2f3q22wTjJsFLi_To9F6Ss45R-/s1600/summer_yankee_candle_haul_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEh2SKL4H0pf-AQB6g0b8tflTl7qL2cEotL4CVHEcAITCcU22Ez64dFfrelXyM2FIZ3ZNd7wvZ0KxgJ_pPDbGJbC8IEf13L2YqLn_Z2Z5r-gFXuZK6S-ed2f3q22wTjJsFLi_To9F6Ss45R-/s1600/summer_yankee_candle_haul_2.jpg" /></a></div> <h2 style="clear: both; text-align: center;"> Hello, readers!</h2> <div class="separator" style="clear: both; text-align: left;"> I thought I'd start my comeback with a post about my recent Yankee Candle purchases. I have to say, in the past few years I've grown a little addicted to these candles. I just have to have one burning at all times, and I usually stock up every month or so and buy 4 scents. They last about a week if I burn them daily, every evening, and I couldn't be more thrilled about them. They're definitely my favorite candle brand, though I'd love to try some Diptyque soon as well. Let's see which summery scents I got in June.</div> <h3 style="text-align: center;"> Yankee Candle Fluffy Towels</h3> My boyfriend loves clean cotton scents, and he adores this one especially. I got it for him - since we both work from home now, it's quite <b>relaxing</b> to get into working mode by burning a lovely scent. This is very <b>calming</b>, somewhat <b>sweet</b> and <b>soothing</b>. It also has some fruity (apple, citrus) notes along with lavender. One that guys might like. I bought it <a href="http://www.yankeecandle.si/index.php/yankee-candle-sveca-fluffy-towels-1.html">here</a> for 25€, but it's also available on the <a href="http://www.yankeecandle.com/fragrance/fluffy-towels/_/N-1z140x6">official YC website.</a><br /> <h3 style="text-align: center;"> Yankee Candle Sicilian Lemon</h3> <div style="text-align: left;"> I've had the Lemon Lavender candle before, and the sales associate told me it's one of their bestsellers. However, it's just not a scent I like. The combination of sharp lemon and calming lavender doesn't work for me at all, and I think the two notes clash. I thought a good substitute would be Sicilian Lemon, which is truly a perfect <b>summer</b> scent. <b>Sweet, sharp and citrusy</b>, it helps me relax and get to work! Available <a href="http://www.yankeecandle.si/index.php/yankee-candle-sveca-sicilian-lemon.html">here</a> for 25€. Couldn't find it on the official website - could be a limited edition scent?</div> <h3 style="text-align: center;"> Yankee Candle Peony</h3> <div style="text-align: left;"> I saw my friend Kim get this, and I absolutely had to have it. I'm a huge fan of peonies and this scent transports me right to my grandma's garden. Her peonies bloom in the beginning of June, and she always gives me a bouquet, every single year. I adore this <b>soft floral </b>scent. It's quite <b>powdery</b>, very <b>gentle</b> and inoffensive. Something everyone would like. Available <a href="http://www.yankeecandle.si/index.php/yankee-candle-sveca-peony.html">here</a> for Slovenia, and <a href="http://www.yankeecandle.com/search?Ntt=peony">here</a> for the US. Limited edition, 25€.</div> <h3 style="text-align: center;"> Yankee Candle Summer Scoop</h3> <div style="text-align: left;"> Now, I generally have a rule that I don't buy the same scent twice, but I've broken it a few times... One of the scents is Vanilla Lime, and the other is Summer Scoop. This is probably my favorite YC scent. It's <b>berry ice cream topped with whipped cream</b> and I adore it. It instantly puts me in a good mood. It's thankfully a permanent scent, and if you're gonna get one of these scents, get this one, because you won't regret it. Available <a href="http://www.yankeecandle.si/index.php/yankee-candle-sveca-summer-scoop.html">here</a>, and <a href="http://www.yankeecandle.com/search?Ntt=summer+scoop">here</a> for the US. 25€.</div> <div style="text-align: left;"> <br /></div> <div style="text-align: center;"> I've been burning a few of these scents already and I adore them. I hope this post inspired you to do some shopping of your own... Ooops, didn't mean to be bad to your wallet!</div> <div style="text-align: center;"> <b><i>What's your favorite YC scent?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/06/summer-2016-yankee-candle-haul.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnNUBJ7FGAvXURSiKKpu2l48hZY5ss2v_3mc7fu8DsKYrOWg6gBkvAiG3JJ_Upo85B8u2HP_9I8CXJVRK1sbxXadShJEZFwbBsaKv-q_9ZGNKDal8GRMb48RbAwo-kgSXdPKuYIoAP3xG0/s72-c/summer_yankee_candle_haul_1.jpg" height="72" width="72"/>
<thr:total>12</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-5474390979492863157</guid>
<pubDate>Sun, 22 May 2016 12:50:00 +0000</pubDate>
<atom:updated>2016-05-22T14:50:10.141+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">afrodita</category>
<category domain="http://www.blogger.com/atom/ns#">armani</category>
<category domain="http://www.blogger.com/atom/ns#">body care</category>
<category domain="http://www.blogger.com/atom/ns#">bourjois</category>
<category domain="http://www.blogger.com/atom/ns#">catrice</category>
<category domain="http://www.blogger.com/atom/ns#">china glaze</category>
<category domain="http://www.blogger.com/atom/ns#">concealer</category>
<category domain="http://www.blogger.com/atom/ns#">essence</category>
<category domain="http://www.blogger.com/atom/ns#">highlighter</category>
<category domain="http://www.blogger.com/atom/ns#">lipstick</category>
<category domain="http://www.blogger.com/atom/ns#">makeup</category>
<category domain="http://www.blogger.com/atom/ns#">nail polish</category>
<category domain="http://www.blogger.com/atom/ns#">oriflame</category>
<category domain="http://www.blogger.com/atom/ns#">perfume</category>
<category domain="http://www.blogger.com/atom/ns#">shower gel</category>
<category domain="http://www.blogger.com/atom/ns#">the balm</category>
<title>Spring 2016 Beauty Picks</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgTMondSx1jBIpN7_slwBKW3YHYA1GilbmBzaEvyxeM_96RjOfDC0ZPQgo8meoUK4kuPb6BFHxTBtE_ux-putNmMAP5r-fcFhAXxPFlXai4eAoTcv6p57_u8vhDnsS5aMzaQgWCmHMZQDII/s1600/spring_2016_beauty_picks_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgTMondSx1jBIpN7_slwBKW3YHYA1GilbmBzaEvyxeM_96RjOfDC0ZPQgo8meoUK4kuPb6BFHxTBtE_ux-putNmMAP5r-fcFhAXxPFlXai4eAoTcv6p57_u8vhDnsS5aMzaQgWCmHMZQDII/s1600/spring_2016_beauty_picks_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhdvmHf0JYZiSCWIDeKE8f8Xyut2pqD7rwlvRfsg4MV1YrBDL0Yc7JncYQz0npJxR-UBi2Lt9RXmVGc22LS_uafc8rrriWF-6NaOur_0VWcXVPvxVCx7ultBwly76naD9f76enuXIuI63Ue/s1600/spring_2016_beauty_picks_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhdvmHf0JYZiSCWIDeKE8f8Xyut2pqD7rwlvRfsg4MV1YrBDL0Yc7JncYQz0npJxR-UBi2Lt9RXmVGc22LS_uafc8rrriWF-6NaOur_0VWcXVPvxVCx7ultBwly76naD9f76enuXIuI63Ue/s1600/spring_2016_beauty_picks_2.jpg" /></a></div> <h3 style="text-align: center;"> Spring is almost over, but I still haven't shown you my beauty picks this season!</h3> <div> I've been loving floral scents and pastels this season and I can't wait to share some of my favorites with you today. I've been liking a really prominent highlight as well. I'm sure you'll fall in love with some of these products too! Let's begin with lipstick...</div> <h4 style="text-align: center;"> Essence Nude &amp; Matte Lipsticks</h4> <div> I've been slowly collecting these over the past few months. They are seriously some of the best lipsticks on the market, and they're incredibly <b>inexpensive </b>as well (2,5-4€ per pop). I love the color <b>Cool Nude</b> especially, and I think the best ones are the nude colors. Strongly recommend these if you can get your hands on them! The nude line is really <b>moisturizing </b>as well, which I love.</div> <h4 style="text-align: center;"> The Balm Mary Loumanizer</h4> <div> Guys, I get the hype. This highlighter is STUNNING. I've been using it pretty much everyday, but beware - this is highlight. On. Fleek! Very <b>prominent </b>color, very <b>intense </b>and beautiful, but if you like a subtle highlight, it's not for you. I just adore it though! It costs around 22€ in Müller and I really recommend it if you're addicted to highlighters - it's a <b>must have</b>!</div> <h4 style="text-align: center;"> Bourjois City Radiance Concealer</h4> <div> I love this product. It's very creamy but at the same time <b>moisturizing </b>and almost gel-like when you apply it. Really <b>great consistency </b>and it gives <b>good coverage</b>, doesn't cake, plus, it feels really pleasant on my skin. I believe the price is around 10€ in drugstores.</div> <div> <h4 style="text-align: center;"> Armani Si EDT</h4> I've talked about this quite a few times now, but I still love it! A more <b>floral</b>, <b>lighter </b>version of the original Si fragrance.<b> Soft, sweet </b>and just perfect with impressive sillage for an EDT. I'd recommend it for spring especially. I got three in a set for 100€ from Sephora.</div> <h4 style="text-align: center;"> Oriflame Bright Bouquet Shower Cream</h4> <div style="text-align: left;"> I've been loving this <b>luxurious </b>shower product from Oriflame. A brand that is too often overlooked in my opinion, as they have some awesome products! I love this <b>floral </b>scented shower cream which <b>lathers </b>up nicely and smells just like spring - perfect for this time of the year. I believe the price is around 8€.</div> <h4 style="text-align: center;"> Afrodita Bouquet of Flowers Body Milk</h4> <div> The perfect product to follow up with after your shower. <b>Delicately scented </b>with a <b>floral </b>perfume mixed with a milky scent, really <b>pampering </b>and again, perfect for spring. Soft and gentle but still very nourishing. I love it, and it's a bargain at around 3-4€ in drugstores.</div> <h4 style="text-align: center;"> Catrice Prime &amp; Fine Beautyfying Primer</h4> <div> I've been absolutely loving this primer. It does it all - gives you a <b>perfect base for foundation</b>, and a really beautiful <b>soft focus finish</b> on your skin. It gives every foundation you apply afterwards a stunning finish. And it's a bargain at around 5€ in drugstores! I think I'll even repurchase this one for summer, it's that great.</div> <h4 style="text-align: center;"> China Glaze in a Lily Bit</h4> <div> Any<b> pastel pink </b>polish is perfect for this time of the year. If you can't get this CG gem, I'd recommend Essie's Fiji though I hope they changed the formulation since I last had it (very thick and streaky). This is a favorite because it <b>applies incredibly well for a pastel color</b>. Beautiful shade and opaque in 2-3 coats, which is surprisingly not the nightmare it usually is. I paid around 3€ on Destination Pretty.</div> <h4 style="text-align: center;"> Catrice The Sky so Fly</h4> A stunning blue, <b>periwinkle </b>color. I just love pastel blues in summer. This says you need to use a base coat on the bottle (I assume a white one?), but it applies perfectly without one. Perfect blue shade and again, <b>easy to apply</b>. And a bargain at around 2,5€.<br /> <br /> <div style="text-align: center;"> There you have it, some of my favorites for this season. Have you tried any of these? I'd love to hear your thoughts on your favorites.</div> <div style="text-align: center;"> <b><i>What is your favorite spring beauty product?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/05/spring-2016-beauty-picks.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEgTMondSx1jBIpN7_slwBKW3YHYA1GilbmBzaEvyxeM_96RjOfDC0ZPQgo8meoUK4kuPb6BFHxTBtE_ux-putNmMAP5r-fcFhAXxPFlXai4eAoTcv6p57_u8vhDnsS5aMzaQgWCmHMZQDII/s72-c/spring_2016_beauty_picks_1.jpg" height="72" width="72"/>
<thr:total>10</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-573279551165979518</guid>
<pubDate>Sun, 15 May 2016 13:47:00 +0000</pubDate>
<atom:updated>2016-05-15T15:47:06.209+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">floral</category>
<category domain="http://www.blogger.com/atom/ns#">fragrance</category>
<category domain="http://www.blogger.com/atom/ns#">jimmy choo</category>
<category domain="http://www.blogger.com/atom/ns#">perfume</category>
<category domain="http://www.blogger.com/atom/ns#">sweet</category>
<title>Jimmy Choo Blossom EDP</title>
<description><div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnjU3a2U8ltHRQF9ntKgMD4H2R9o_I0_Z4S0Q0tEMOBBMLcghBhzy-crYQDWHreK_pX_bns4Om2qHCM87b1zTa-nHs13mInNpJzX7V8DOhgQYJnodzZWXuUViEt-lxgUw2Ve3tNKgn5sas/s1600/jimmy_choo_blossom_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnjU3a2U8ltHRQF9ntKgMD4H2R9o_I0_Z4S0Q0tEMOBBMLcghBhzy-crYQDWHreK_pX_bns4Om2qHCM87b1zTa-nHs13mInNpJzX7V8DOhgQYJnodzZWXuUViEt-lxgUw2Ve3tNKgn5sas/s1600/jimmy_choo_blossom_1.jpg" /></a></div> <br /> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg-GoHNhHRPWA6K5ySnRQW4t1o7Zohj8cAPlQoY0ONr9tKUDC4RqVcjS3DUGnGnR_keq_RQixk22auRvge8iR09t9vunUt3QfUFa9whtf-n36TTvwTRP_uwmU79nz6e9v16ByoOBN44x5v1/s1600/jimmy_choo_blossom_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg-GoHNhHRPWA6K5ySnRQW4t1o7Zohj8cAPlQoY0ONr9tKUDC4RqVcjS3DUGnGnR_keq_RQixk22auRvge8iR09t9vunUt3QfUFa9whtf-n36TTvwTRP_uwmU79nz6e9v16ByoOBN44x5v1/s1600/jimmy_choo_blossom_2.jpg" /></a></div> <br /> <h3 style="text-align: center;"> Let's start with a long overdue where have I been...</h3> I took a trip to Amsterdam in April, and on the second-to-last day, I fell down some stairs at the metro station. It was the stupidest accident really, but it left me with a broken right hand as well as a shattered wrist. I'm currently wearing a cast up to my shoulder (yep, writing this one-handed!) and will need to keep it on for at least two more weeks. I might also need surgery.<br /> <br /> Personal tragedies aside, I really missed this little blog of mine, so I decided to do a shorter post today to take my mind off this stupid situation! So why not talk about perfume, one of my favorite things in the world? ;)<br /> <br /> When the first <b>Jimmy Choo </b>fragrance came out, I really wanted it, only to discover it had too much patchouli for my taste. But this new edition appropriately named <b>Blossom</b>, seemed right up my alley.<br /> <br /> Blossom is a <b>sweet floral </b>with notes of berries, rose, citrus and musk. Not a groundbreakingly different scent, but lovely nonetheless. It's <b>sweet in a fresh and citrusy way</b>, not cloying and decadent like some deeper sweet scents. The staying power leaves something to be desired, but the sillage is great. Overall an adorable scent perfect for spring and summer, aimed at 20-somethings and younger. Cute!<br /> <br /> You can purchase the fragrance at <a href="http://www.allbeauty.com/search/?q=jimmy+choo+blossom">All Beauty </a>from 44€. I'd recommend it to fans of Prada Candy Eau Florale, it's like Prada's fun, flirty sister!<br /> <div style="text-align: center;"> <b><i>What perfume are you wearing today?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/05/jimmy-choo-blossom-edp.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhnjU3a2U8ltHRQF9ntKgMD4H2R9o_I0_Z4S0Q0tEMOBBMLcghBhzy-crYQDWHreK_pX_bns4Om2qHCM87b1zTa-nHs13mInNpJzX7V8DOhgQYJnodzZWXuUViEt-lxgUw2Ve3tNKgn5sas/s72-c/jimmy_choo_blossom_1.jpg" height="72" width="72"/>
<thr:total>6</thr:total>
</item>
<item>
<guid isPermaLink="false">tag:blogger.com,1999:blog-2743690106034386179.post-5925251469881632783</guid>
<pubDate>Fri, 08 Apr 2016 18:34:00 +0000</pubDate>
<atom:updated>2016-04-08T20:34:29.403+02:00</atom:updated>
<category domain="http://www.blogger.com/atom/ns#">avon</category>
<category domain="http://www.blogger.com/atom/ns#">bodycare</category>
<category domain="http://www.blogger.com/atom/ns#">drugstore</category>
<category domain="http://www.blogger.com/atom/ns#">lip balm</category>
<title>Avon Care Cocoa Butter Line</title>
<description><div class="separator" style="clear: both; text-align: center;"> </div> <div class="separator" style="clear: both; text-align: center;"> <a href="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiiiHyNw7SleKDVTurvYWByGbsP68U2rfgojaeYOaVNw4HRoXUCj60FXI4dc_JPLPuivUGnjoYTb51gn18bYORrYvxVMpg9iPcbm6Hc56hEDQ6PSZdQ8nUYaeiftIO2PYS3T8Ofz4FXF5Eo/s1600/avon_care_cocoa_butter_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiiiHyNw7SleKDVTurvYWByGbsP68U2rfgojaeYOaVNw4HRoXUCj60FXI4dc_JPLPuivUGnjoYTb51gn18bYORrYvxVMpg9iPcbm6Hc56hEDQ6PSZdQ8nUYaeiftIO2PYS3T8Ofz4FXF5Eo/s1600/avon_care_cocoa_butter_1.jpg" /></a></div> <h4 style="text-align: center;"> It rarely happens I fall in love with a whole line of products... But this one is a winner!</h4> <div> I've been loving quite a few Avon products recently, but this line is definitely a firm favorite. It consists of four products, all of which have really manage to impress me. I haven't been using them for too long, so this will be a shorter post, but let's see what my thoughts are...</div> <div> <br /></div> <h3 style="text-align: center;"> Avon Cocoa Butter Rich Cream</h3> <div> Supposedly, you can use this on your face as well as your body, but I prefer it for just <b>bodycare</b>. It's indeed a rich cream but it has a <b>light consistency and sinks in fast</b>. Smells divine and feels like a lighter version of a body butter, but is just as nourishing and moisturizing! Love this stuff... You can buy it <a href="http://www.avon.si/PRSuite/static/p/sl.html?personal-care/body-care/p/0753-4">here </a>for less than 4€!</div> <h3 style="text-align: center;"> Avon Cocoa Butter Hand Cream</h3> <div> I just love anything with cocoa butter and having a hand cream with that ingredient means it's extremely nourishing and great for <b>cuticles </b>as well. I love using this <b>before bed </b>as my hands are really soft when I wake up. A bit too much to put in my purse, but a love nonetheless! Available <a href="http://www.avon.si/PRSuite/static/p/sl.html?personal-care/hand-care/p/4049-3">here </a>for less than 2€.</div> <h3 style="text-align: center;"> Avon Cocoa Butter Lip Balm</h3> <div> I can't seem to find this on the Avon website, but this is a great lip balm in a <b>squeezy </b>tube. I like to use it as a <b>prevantative </b>lip balm (when my lips are chapped already, I prefer Blistex). It's very nourishing - and it tastes great... Not sure I should be eating is as much as I do. :P I think the price is around 4€ if you can still find it anywhere!</div> <h3 style="text-align: center;"> Avon Cocoa Butter Body Lotion</h3> <div> Another great product with a surprisingly <b>light </b>consistency, given that it contains Cocoa Butter. <b>Pleasant</b>, light and <b>cooling</b>, with a really nice scent just like the rest of the range. I really love this stuff. Available here for a little over 4€.</div> <div> <br /></div> <div> My only hope for this line is that they would add some more products - perhaps an in-shower lotion like Nivea has? That product is one of my favorites and I'd love to see more brands attempt to make something similar. A body scrub would also be lovely, as well as a lip scrub... Ah, I hope they bring out more product as I really am a huge fan of this line!</div> <div> <br /></div> <div> Blogger of the day is <b>Laura </b>from <a href="http://www.buynowbloglater.com/">Buy Now, Blog Later.</a> Some of you old school YT peeps may know Laura as lollipop26, and if you're anything like me, you were also addicted to her OG Youtube videos in the olden days (god, I'm old). Now, I absolutely ADORE Laura's blog and Instagram, and her fashion choices are a daily inspiration! Can't get enough of her content, and she's so stunning as well and seems like a total darling. I've followed her for years and don't see myself stopping any time soon!</div> <div style="text-align: center;"> <b><i>What is your favorite product with cocoa butter?</i></b></div> </description>
<link>http://nothinfancyreally.blogspot.com/2016/04/avon-care-cocoa-butter-line.html</link>
<author>noreply@blogger.com (Živa)</author>
<media:thumbnail xmlns:media="http://search.yahoo.com/mrss/" url="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEiiiHyNw7SleKDVTurvYWByGbsP68U2rfgojaeYOaVNw4HRoXUCj60FXI4dc_JPLPuivUGnjoYTb51gn18bYORrYvxVMpg9iPcbm6Hc56hEDQ6PSZdQ8nUYaeiftIO2PYS3T8Ofz4FXF5Eo/s72-c/avon_care_cocoa_butter_1.jpg" height="72" width="72"/>
<thr:total>8</thr:total>
</item>
</channel>
</rss>